You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameAlcohol O-acetyltransferase 1
Synonyms
  • AATase 1
Gene NameATF1
Enzyme Class
Biological Properties
General FunctionInvolved in alcohol O-acetyltransferase activity
Specific FunctionCatalyzes the esterification of isoamyl alcohol and various other alcohols by acetyl-CoA
Cellular LocationMembrane; Peripheral membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG Reactions
Acetyl-CoA + 2-methylbutan-1-ol2-Methylbutyl acetate + Coenzyme A
Ethanol + Acetyl-CoAEthyl acetate + Coenzyme A
Acetyl-CoA + isoamylolisoamyl acetate + Coenzyme A
Acetyl-CoA + isobutanolisobutyl acetate + Coenzyme A
Acetyl-CoA + 2-phenylethanolphenethyl acetate + Coenzyme A
Metabolites
YMDB IDNameView
YMDB00045Coenzyme AShow
YMDB00312Acetyl-CoAShow
YMDB005672-methylbutan-1-olShow
YMDB005682-Methylbutyl acetateShow
YMDB00569Ethyl acetateShow
YMDB00570isoamylolShow
YMDB00571isoamyl acetateShow
YMDB00572isobutyl acetateShow
YMDB00573isobutanolShow
YMDB00574phenethyl acetateShow
YMDB00790Isopentyl acetateShow
YMDB00798IsopentanolShow
YMDB00883EthanolShow
YMDB01384Hexyl acetateShow
YMDB01390Propyl acetateShow
YMDB014701-PentanolShow
YMDB01471Pentyl acetateShow
YMDB01472Phenylethyl acetateShow
YMDB014731-HexanolShow
YMDB014751-HeptanolShow
YMDB01476Heptyl acetateShow
YMDB01477Octyl acetateShow
GO Classification
Component
Not Available
Function
transferase activity, transferring acyl groups
transferase activity, transferring acyl groups other than amino-acyl groups
acyltransferase activity
O-acyltransferase activity
O-acetyltransferase activity
alcohol O-acetyltransferase activity
catalytic activity
transferase activity
Process
metabolic process
small molecule metabolic process
alcohol metabolic process
Gene Properties
Chromosome Locationchromosome 15
LocusYOR377W
Gene Sequence>1578 bp ATGAATGAAATCGATGAGAAAAATCAGGCCCCCGTGCAACAAGAATGCCTGAAAGAGATG ATTCAGAATGGGCATGCTCGGCGTATGGGATCTGTTGAAGATCTGTATGTTGCTCTCAAC AGACAAAACTTATATCGGAACTTCTGCACATATGGAGAATTGAGTGATTACTGTACTAGG GATCAGCTCACATTAGCTTTGAGGGAAATCTGCCTGAAAAATCCAACTCTTTTACATATT GTTCTACCAATAAGATGGCCAAATCATGAAAATTATTATCGCAGTTCCGAATACTATTCA CGGCCACATCCAGTGCATGATTATATTTCAGTATTACAGGAATTGAAACTGAGTGGTGTG GTTCTCAATGAACAACCTGAGTACAGTGCAGTAATGAAGCAAATATTAGAAGAATTCAAA AATAGTAAGGGTTCCTATACTGCAAAAATTTTTAAACTTACTACCACTTTGACTATTCCT TACTTTGGACCAACAGGACCGAGTTGGCGGCTAATTTGTCTTCCAGAAGAGCACACAGAA AAGTGGAAAAAATTTATCTTTGTATCTAATCATTGCATGTCTGATGGTCGGTCTTCGATC CACTTTTTTCATGATTTAAGAGACGAATTAAATAATATTAAAACTCCACCAAAAAAATTA GATTACATTTTCAAGTACGAGGAGGATTACCAATTGTTGAGGAAACTTCCAGAACCGATC GAAAAGGTGATAGACTTTAGACCACCGTACTTGTTTATTCCGAAGTCACTTCTTTCGGGT TTCATCTACAATCATTTGAGATTTTCTTCAAAAGGTGTCTGTATGAGAATGGATGATGTG GAAAAAACCGATGATGTTGTCACCGAGATCATCAATATTTCACCAACAGAATTTCAAGCG ATTAAAGCAAATATTAAATCAAATATCCAAGGTAAGTGTACTATCACTCCGTTTTTACAT GTTTGTTGGTTTGTATCTCTTCATAAATGGGGTAAATTTTTCAAACCATTGAACTTCGAA TGGCTTACGGATATTTTTATCCCCGCAGATTGCCGCTCACAACTACCAGATGATGATGAA ATGAGACAGATGTACAGATATGGCGCTAACGTTGGATTTATTGACTTCACCCCATGGATA AGCGAATTTGACATGAATGATAACAAAGAAAAATTTTGGCCACTTATTGAGCACTACCAT GAAGTAATTTCGGAAGCTTTAAGAAATAAAAAGCACCTCCATGGCTTAGGGTTCAATATA CAAGGCTTCGTTCAAAAATATGTGAATATTGACAAGGTAATGTGCGATCGTGCCATCGGG AAAAGACGCGGAGGTACATTGTTAAGCAATGTAGGTCTGTTTAATCAGTTAGAGGAGCCC GATGCCAAATATTCTATATGCGATTTGGCATTTGGCCAATTTCAAGGATCCTGGCACCAA GCATTTTCCTTGGGTGTTTGTTCGACTAATGTAAAGGGGATGAATATTGTTGTTGCTTCA ACAAAAAATGTTGTTGGTAGCCAAGAATCTCTCGAAGAGCTTTGCTCCATTTATAAAGCT CTCCTTTTAGGCCCTTAG
Protein Properties
Pfam Domain Function
Protein Residues525
Protein Molecular Weight61035.5
Protein Theoretical pI6.96
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Alcohol O-acetyltransferase 1 MNEIDEKNQAPVQQECLKEMIQNGHARRMGSVEDLYVALNRQNLYRNFCTYGELSDYCTR DQLTLALREICLKNPTLLHIVLPTRWPNHENYYRSSEYYSRPHPVHDYISVLQELKLSGV VLNEQPEYSAVMKQILEEFKNSKGSYTAKIFKLTTTLTIPYFGPTGPSWRLICLPEEHTE KWKKFIFVSNHCMSDGRSSIHFFHDLRDELNNIKTPPKKLDYIFKYEEDYQLLRKLPEPI EKVIDFRPPYLFIPKSLLSGFIYNHLRFSSKGVCMRMDDVEKTDDVVTEIINISPTEFQA IKANIKSNIQGKCTITPFLHVCWFVSLHKWGKFFKPLNFEWLTDIFIPADCRSQLPDDDE MRQMYRYGANVGFIDFTPWISEFDMNDNKENFWPLIEHYHEVISEALRNKKHLHGLGFNI QGFVQKYVNIDKVMCDRAIGKRRGGTLLSNVGLFNQLEEPDAKYSICDLAFGQFQGSWHQ AFSLGVCSTNVKGMNIVVASTKNVVGSQESLEELCSIYKALLLGP
References
External Links
ResourceLink
Saccharomyces Genome Database ATF1
Uniprot IDP40353
Uniprot NameATF1_YEAST
GenBank Gene IDD26554
Genebank Protein ID531272
General Reference
  • Fujii, T., Nagasawa, N., Iwamatsu, A., Bogaki, T., Tamai, Y., Hamachi, M. (1994). "Molecular cloning, sequence analysis, and expression of the yeast alcohol acetyltransferase gene." Appl Environ Microbiol 60:2786-2792.8085822
  • Dujon, B., Albermann, K., Aldea, M., Alexandraki, D., Ansorge, W., Arino, J., Benes, V., Bohn, C., Bolotin-Fukuhara, M., Bordonne, R., Boyer, J., Camasses, A., Casamayor, A., Casas, C., Cheret, G., Cziepluch, C., Daignan-Fornier, B., Dang, D. V., de Haan, M., Delius, H., Durand, P., Fairhead, C., Feldmann, H., Gaillon, L., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV." Nature 387:98-102.9169874
  • Minetoki, T., Bogaki, T., Iwamatsu, A., Fujii, T., Hamachi, M. (1993). "The purification, properties and internal peptide sequences of alcohol acetyltransferase isolated from Saccharomyces cerevisiae Kyokai No. 7." Biosci Biotechnol Biochem 57:2094-2098.7764365
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106