Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameDolichyl-phosphate beta-glucosyltransferase
Synonyms
  • DolP-glucosyltransferase
  • Asparagine-linked glycosylation protein 5
Gene NameALG5
Enzyme Class
Biological Properties
General FunctionCell wall/membrane/envelope biogenesis
Specific FunctionUDP-glucose + dolichyl phosphate = UDP + dolichyl beta-D-glucosyl phosphate
Cellular LocationEndoplasmic reticulum membrane; Single-pass type II membrane protein.
SMPDB Pathways
N-Glycan biosynthesisPW002501 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
N-Glycan biosynthesisec00510 Map00510
SMPDB Reactions
Uridine diphosphate glucose + Dolichol phosphateUridine 5'-diphosphate + Dolichyl b-D-glucosyl phosphate
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00212Uridine diphosphate glucoseShow
YMDB00241Dolichyl b-D-glucosyl phosphateShow
YMDB00307Uridine 5'-diphosphateShow
YMDB00864Dolichol phosphateShow
YMDB00928Dolichol-20Show
GO ClassificationNot Available
Gene Properties
Chromosome Locationchromosome 16
LocusYPL227C
Gene Sequence>1005 bp ATGAGAGCGTTGAGATTCCTGATTGAGAACAGAAACACTGTCTTTTTTACGCTCTTAGTA GCCTTGGTGCTTTCACTGTATTTATTGGTCTATTTATTTTCGCATACACCAAGGCCGCCA TATCCAGAGGAGCTCAAATACATAGCTATTGATGAAAAAGGTCATGAAGTTAGTCGTGCC TTACCTAACTTGAATGAACACCAAGATGACGAAGAAATATTTTTATCTGTTGTTATCCCA AGCTATAATGAGACAGGTAGAATTTTACTAATGTTGACAGACGCAATCAGCTTTTTAAAG GAAAAATATGGTTCCAGATGGGAGATTGTCATAGTGGATGATGGTTCCACAGATAATACC ACACAATACTGTTTGAAAATTTGTAAAGAACAGTTCAAATTGAACTACGAACAATTCAGA ATCATCAAGTTTTCTCAAAACAGAGGCAAAGGTGGCGCAGTGAGACAAGGTTTTTTACAT ATTAGAGGTAAGTATGGTCTTTTTGCCGATGCTGATGGTGCTAGTAAGTTCAGTGATGTA GAAAAACTAATAGATGCTATTAGCAAAATTGAAACGTCTAGTACAGATCTAAAAACGACT AAACCAGCAGTAGCAATTGGTTCCAGAGCACATATGGTAAATACCGAAGCCGTCATAAAG AGATCAATGATAAGAAACTGCTTGATGTACGGTTTCCATACCTTAGTTTTCATCTTCGGC ATCAGGTCTATCAAAGACACACAATGTGGATTCAAATTGTTCAACAGAGCCGCTATATTG AAAATTTTTCCGTATTTGCATACAGAGGGTTGGATCTTTGACGTTGAAATTTTGATCTTA GCCATCAGAAAAAGAATCCAAATTGAGGAGATACCAATTTCCTGGCATGAGGTTGATGGC TCTAAGATGGCTTTAGCTATTGATAGTATCAAAATGGCGAAAGACTTGGTTATTATAAGA ATGGCCTATTTATTAGGGATATATAGAGATAATAAGAAATGTTAG
Protein Properties
Pfam Domain Function
Protein Residues334
Protein Molecular Weight38346.39844
Protein Theoretical pI9.03
Signalling Regions
  • None
Transmembrane Regions
  • 13-33
Protein Sequence>Dolichyl-phosphate beta-glucosyltransferase MRALRFLIENRNTVFFTLLVALVLSLYLLVYLFSHTPRPPYPEELKYIAIDEKGHEVSRA LPNLNEHQDDEEIFLSVVIPSYNETGRILLMLTDAISFLKEKYGSRWEIVIVDDGSTDNT TQYCLKICKEQFKLNYEQFRIIKFSQNRGKGGAVRQGFLHIRGKYGLFADADGASKFSDV EKLIDAISKIETSSTDLKTTKPAVAIGSRAHMVNTEAVIKRSMIRNCLMYGFHTLVFIFG IRSIKDTQCGFKLFNRAAILKIFPYLHTEGWIFDVEILILAIRKRIQIEEIPISWHEVDG SKMALAIDSIKMAKDLVIIRMAYLLGIYRDNKKC
References
External Links
ResourceLink
Saccharomyces Genome Database ALG5
Uniprot IDP40350
Uniprot NameALG5_YEAST
GenBank Gene IDX77573
Genebank Protein ID535141
General Reference
  • Heesen, S., Lehle, L., Weissmann, A., Aebi, M. (1994). "Isolation of the ALG5 locus encoding the UDP-glucose:dolichyl-phosphate glucosyltransferase from Saccharomyces cerevisiae." Eur J Biochem 224:71-79.8076653
  • Bussey, H., Storms, R. K., Ahmed, A., Albermann, K., Allen, E., Ansorge, W., Araujo, R., Aparicio, A., Barrell, B., Badcock, K., Benes, V., Botstein, D., Bowman, S., Bruckner, M., Carpenter, J., Cherry, J. M., Chung, E., Churcher, C., Coster, F., Davis, K., Davis, R. W., Dietrich, F. S., Delius, H., DiPaolo, T., Hani, J., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI." Nature 387:103-105.9169875
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106