You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameLow molecular weight phosphotyrosine protein phosphatase
Synonyms
  • Low molecular weight cytosolic acid phosphatase
  • PTPase
Gene NameLTP1
Enzyme Class
Biological Properties
General FunctionInvolved in protein tyrosine phosphatase activity
Specific FunctionActs on tyrosine phosphorylated proteins, low-MW aryl phosphates and natural and synthetic acyl phosphates
Cellular LocationCytoplasm
SMPDB Pathways
Riboflavin metabolismPW002443 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Riboflavin metabolismec00740 Map00740
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00890waterShow
YMDB00907phosphateShow
GO Classification
Component
Not Available
Function
hydrolase activity
hydrolase activity, acting on ester bonds
phosphoric ester hydrolase activity
phosphatase activity
protein tyrosine phosphatase activity
catalytic activity
phosphoprotein phosphatase activity
Process
metabolic process
dephosphorylation
protein amino acid dephosphorylation
cellular metabolic process
phosphorus metabolic process
phosphate metabolic process
Gene Properties
Chromosome Locationchromosome 16
LocusYPR073C
Gene Sequence>486 bp ATGACAATTGAAAAACCAAAAATATCGGTCGCATTCATTTGTTTGGGTAACTTCTGTAGA TCACCAATGGCGGAAGCCATTTTCAAACATGAAGTCGAAAAGGCTAATCTAGAAAATCGA TTCAACAAGATTGATTCATTTGGCACTTCTAATTATCATGTGGGGGAAAGCCCTGATCAT CGTACAGTGTCCATTTGTAAGCAACATGGCGTCAAGATTAATCATAAAGGGAAACAAATA AAGACCAAACACTTCGATGAATATGACTATATAATCGGTATGGATGAATCCAACATTAAT AACCTAAAAAAAATACAACCTGAAGGTTCTAAAGCTAAAGTTTGCCTTTTTGGTGATTGG AATACTAATGATGGCACTGTGCAGACCATTATTGAAGATCCTTGGTATGGTGACATACAA GATTTCGAGTACAACTTCAAACAAATCACCTATTTCTCCAAACAGTTTTTAAAAAAAGAG TTATAA
Protein Properties
Pfam Domain Function
Protein Residues161
Protein Molecular Weight18675.09961
Protein Theoretical pI7.54
PDB Fileshow
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Low molecular weight phosphotyrosine protein phosphatase MTIEKPKISVAFICLGNFCRSPMAEAIFKHEVEKANLENRFNKIDSFGTSNYHVGESPDH RTVSICKQHGVKINHKGKQIKTKHFDEYDYIIGMDESNINNLKKIQPEGSKAKVCLFGDW NTNDGTVQTIIEDPWYGDIQDFEYNFKQITYFSKQFLKKEL
References
External Links
ResourceLink
Saccharomyces Genome Database LTP1
Uniprot IDP40347
Uniprot NamePPAL_YEAST
GenBank Gene IDAY692891
Genebank Protein ID51013233
PDB ID
1D1P
General Reference
  • Ostanin, K., Pokalsky, C., Wang, S., Van Etten, R. L. (1995). "Cloning and characterization of a Saccharomyces cerevisiae gene encoding the low molecular weight protein-tyrosine phosphatase." J Biol Chem 270:18491-18499.7629177
  • Bussey, H., Storms, R. K., Ahmed, A., Albermann, K., Allen, E., Ansorge, W., Araujo, R., Aparicio, A., Barrell, B., Badcock, K., Benes, V., Botstein, D., Bowman, S., Bruckner, M., Carpenter, J., Cherry, J. M., Chung, E., Churcher, C., Coster, F., Davis, K., Davis, R. W., Dietrich, F. S., Delius, H., DiPaolo, T., Hani, J., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI." Nature 387:103-105.9169875
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956