Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameAmmonium transporter MEP1
SynonymsNot Available
Gene NameMEP1
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in ammonium transmembrane transporter activity
Specific FunctionTransporter for ammonium (both charged and uncharged NH3 and NH4) to use as a nitrogen source. Can also transport methylamine. The affinity of MEP1 is about twenty times lower than that of MEP2. MEP3 has the lowest affinity
Cellular LocationMembrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00423AmmoniumShow
GO Classification
Component
cell part
membrane
Function
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
cation transmembrane transporter activity
organic cation transmembrane transporter activity
ammonium transmembrane transporter activity
transporter activity
transmembrane transporter activity
Process
transmembrane transport
establishment of localization
transport
Gene Properties
Chromosome Locationchromosome 7
LocusYGR121C
Gene Sequence>1479 bp ATGGAGAGTCGAACTACAGGGCCTTTAACGACTGAAACCTACGATGGCCCCACTGTGGCC TTCATGATATTAGGTGCCGCCCTAGTATTTTTTATGGTGCCCGGATTGGGATTCTTGTAC TCCGGATTGGCAAGAAGGAAGTCTGCACTAGCACTAATCTGGGTTGTATTAATGGCGACT TTGGTCGGTATACTGCAATGGTATTTCTGGGGTTACTCTCTAGCTTTTTCAAAGTCCGCT CCGAATAATAAATTCATTGGGAATCTAGATTCGTTTGGCTTTAGAAACGTGTACGGAAAA AAATTCGATGAAGATGCCTACCCTGAGCTCGCGTATGCAACCTTCCAAATGATGTTTTCG TGCGTCAACTTAAGTATTATCGCTGGCGCCACTGCCGAAAGAGGCAGGCTGCTACCGCAC ATGGTTTTTCTCTTTATTCTAGCTACCATTGGATATTGTCCAGTGACGTATTGGATTTGG TCACCAGGTGGTTGGGCATACCAATGGGGAGTCCTCGATTGGGCAGGCGGCGGCAACATT GAAATATTAAGCGCTGTTTCCGGGTTTGTTTACTCTTGGTTTTTGGGCAAAAGAAATGAA AAGTTACTGATAAATTTCAGGCCTCATAATGTTTCATTGGTCACTCTAGGCACATCCATA CTGTGGTTTGGCTGGCTGCTATTTAATTCTGCATCCTCATTATCCCCAAATTTGAGGTCA GTTTATGCATTCATGAATACATGTCTCAGTGCCATTACTGGTGGGATGACGTGGTGTCTT CTGGATTACAGATCGGAGAAGAAATGGTCGACAGTTGGTCTGTGCTCCGGTATCATTTCT GGGCTGGTGGCTGCAACGCCAAGCTCAGGCTGTATAACCCTTTACGGTTCACTTATTCAA GGCATTGTGGCGGGGGTAGTGTGTAACTTTGCGACGAAGTTGAAATACTACGCTAAAGTA GATGATGCCATGGACATTCTAGCTGAGCACGGGGTTGCAGGCGTAATAGGACTAATTTTC AATGCCCTTTTTGGAGCAGACTGGGTCATTGGTATGGATGGCACTACAGAGCACGAGGGC GGCTGGGTAACTCACAATTACAAGCAAATGTATAAGCAGATCGCTTACATTGCCGCATCC ATTGGGTACACTGCTGCTGTAACTGCAATAATCTGCTTTGTGCTCGGCTACATACCCGGT ATGAGGCTAAGAATATCAGAAGAGGCAGAGGAGGCGGGTATGGACGAAGATCAAATTGGC GAATTTGCGTACGATTATGTGGAAGTGAGAAGAGATTACTATCTATGGGGTGTAGACGAA GATTCACAACGCTCTGATGTAAATCACCGGGTGAACAACGCTCATTTGGCCGCTGAACGT AGCAGTAGCGGTACTAATAGTTCCTCGGATGGGAATGGAGAAATGATTCAATCCGAAAAG ATCCTACCAATTCATCAAGAAGATCCTGCCAATAGGTAA
Protein Properties
Pfam Domain Function
Protein Residues492
Protein Molecular Weight54201.60156
Protein Theoretical pI5.24
Signalling Regions
  • None
Transmembrane Regions
  • 19-39
  • 50-70
  • 110-130
  • 141-161
  • 175-195
  • 211-231
  • 241-261
  • 269-289
  • 291-311
  • 332-352
  • 374-394
Protein Sequence>Ammonium transporter MEP1 MESRTTGPLTTETYDGPTVAFMILGAALVFFMVPGLGFLYSGLARRKSALALIWVVLMAT LVGILQWYFWGYSLAFSKSAPNNKFIGNLDSFGFRNVYGKKFDEDAYPELAYATFQMMFS CVNLSIIAGATAERGRLLPHMVFLFILATIGYCPVTYWIWSPGGWAYQWGVLDWAGGGNI EILSAVSGFVYSWFLGKRNEKLLINFRPHNVSLVTLGTSILWFGWLLFNSASSLSPNLRS VYAFMNTCLSAITGGMTWCLLDYRSEKKWSTVGLCSGIISGLVAATPSSGCITLYGSLIQ GIVAGVVCNFATKLKYYAKVDDAMDILAEHGVAGVIGLIFNALFGADWVIGMDGTTEHEG GWVTHNYKQMYKQIAYIAASIGYTAAVTAIICFVLGYIPGMRLRISEEAEEAGMDEDQIG EFAYDYVEVRRDYYLWGVDEDSQRSDVNHRVNNAHLAAERSSSGTNSSSDGNGEMIQSEK ILPIHQEDPANR
References
External Links
ResourceLink
Saccharomyces Genome Database MEP1
Uniprot IDP40260
Uniprot NameMEP1_YEAST
GenBank Gene IDX77608
Genebank Protein ID536819
General Reference
  • Marini, A. M., Vissers, S., Urrestarazu, A., Andre, B. (1994). "Cloning and expression of the MEP1 gene encoding an ammonium transporter in Saccharomyces cerevisiae." EMBO J 13:3456-3463.8062822
  • Van Dyck, L., Tettelin, H., Purnelle, B., Goffeau, A. (1997). "An 18.3 kb DNA fragment from yeast chromosome VII carries four unknown open reading frames, the gene for an Asn synthase, remnants of Ty and three tRNA genes." Yeast 13:171-176.9046098
  • Tettelin, H., Agostoni Carbone, M. L., Albermann, K., Albers, M., Arroyo, J., Backes, U., Barreiros, T., Bertani, I., Bjourson, A. J., Bruckner, M., Bruschi, C. V., Carignani, G., Castagnoli, L., Cerdan, E., Clemente, M. L., Coblenz, A., Coglievina, M., Coissac, E., Defoor, E., Del Bino, S., Delius, H., Delneri, D., de Wergifosse, P., Dujon, B., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII." Nature 387:81-84.9169869
  • Marini, A. M., Soussi-Boudekou, S., Vissers, S., Andre, B. (1997). "A family of ammonium transporters in Saccharomyces cerevisiae." Mol Cell Biol 17:4282-4293.9234685
  • Soupene, E., Ramirez, R. M., Kustu, S. (2001). "Evidence that fungal MEP proteins mediate diffusion of the uncharged species NH(3) across the cytoplasmic membrane." Mol Cell Biol 21:5733-5741.11486013
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258