You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameGDP-mannose transporter 1
Synonyms
  • GMT 1
  • Low dye-binding protein 3
  • Morphogenesis checkpoint-dependent protein 3
  • Vanadate resistance glycosylation protein 4
Gene NameVRG4
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in transmembrane transport
Specific FunctionInvolved in the import of GDP-mannose from the cytoplasm into the Golgi lumen. Defective copy causes severe glycosylation defect and abnormal retention of soluble endoplasmic reticulum proteins. Involved in vanadate sensitivity
Cellular LocationGolgi apparatus membrane; Multi-pass membrane protein. Cytoplasmic vesicle membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00202Guanosine diphosphate mannoseShow
YMDB00261Guanosine monophosphateShow
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
substrate-specific transmembrane transporter activity
carbohydrate transmembrane transporter activity
nucleotide-sugar transmembrane transporter activity
transporter activity
transmembrane transporter activity
Process
transport
carbohydrate transport
nucleotide-sugar transport
transmembrane transport
establishment of localization
Gene Properties
Chromosome Locationchromosome 7
LocusYGL225W
Gene Sequence>1014 bp ATGTCTGAATTGAAAACAGGTCATGCAGGCCATAACCCTTGGGCTTCAGTTGCCAATTCC GGTCCGATCTCTATTTTATCCTACTGTGGTTCCTCTATTTTAATGACGGTGACTAACAAG TTCGTCGTCAATTTGAAGGATTTCAACATGAACTTTGTCATGCTTTTCGTGCAATCTTTG GTTTGTACTATAACCTTGATTATCCTACGTATACTGGGCTATGCGAAGTTCCGTTCATTA AACAAAACAGACGCCAAGAACTGGTTCCCTATTTCCTTTTTACTGGTCTTGATGATCTAC ACCTCTTCGAAGGCTTTACAATACTTGGCTGTTCCAATTTACACCATTTTCAAGAATTTG ACTATTATCTTGATTGCTTATGGTGAGGTTCTCTTTTTTGGTGGCTCTGTCACCTCCATG GAATTGTCATCATTTTTGTTGATGGTCCTTTCTTCTGTCGTTGCAACTTGGGGTGACCAG CAAGCTGTGGCTGCCAAGGCTGCTTCATTGGCTGAAGGAGCAGCCGGTGCTGTTGCCTCC TTTAACCCAGGTTATTTCTGGATGTTCACCAACTGTATCACTTCTGCATTATTCGTTCTT ATAATGAGAAAGAGAATTAAGTTAACTAACTTCAAGGATTTCGACACTATGTTTTACAAC AATGTTTTGGCTCTACCTATTCTATTGCTGTTTTCTTTCTGTGTGGAAGATTGGTCTTCA GTTAATTTGACCAATAACTTTTCTAACGATTCGCTAACTGCTATGATCATCAGTGGTGTT GCATCCGTCGGTATTTCTTACTGTTCCGGTTGGTGTGTTCGTGTTACTTCGTCTACTACA TATTCGATGGTAGGGGCTTTGAACAAGCTGCCAATTGCCTTGTCTGGTTTGATTTTCTTT GATGCTCCAAGAAACTTCTTATCTATTCTCTCCATTTTTATTGGTTTCCTATCAGGTATT ATTTATGCTGTTGCCAAACAAAAGAAGCAACAAGCCCAACCTTTACGTAAATGA
Protein Properties
Pfam Domain Function
Protein Residues337
Protein Molecular Weight37018.30078
Protein Theoretical pI9.7
Signalling Regions
  • None
Transmembrane Regions
  • 17-37
  • 52-72
  • 93-113
  • 120-140
  • 145-165
  • 181-201
  • 216-236
  • 253-273
  • 280-300
  • 305-325
Protein Sequence>GDP-mannose transporter 1 MSELKTGHAGHNPWASVANSGPISILSYCGSSILMTVTNKFVVNLKDFNMNFVMLFVQSL VCTITLIILRILGYAKFRSLNKTDAKNWFPISFLLVLMIYTSSKALQYLAVPIYTIFKNL TIILIAYGEVLFFGGSVTSMELSSFLLMVLSSVVATWGDQQAVAAKAASLAEGAAGAVAS FNPGYFWMFTNCITSALFVLIMRKRIKLTNFKDFDTMFYNNVLALPILLLFSFCVEDWSS VNLTNNFSNDSLTAMIISGVASVGISYCSGWCVRVTSSTTYSMVGALNKLPIALSGLIFF DAPRNFLSILSIFIGFLSGIIYAVAKQKKQQAQPLRK
References
External Links
ResourceLink
Saccharomyces Genome Database VRG4
Uniprot IDP40107
Uniprot NameGMT1_YEAST
GenBank Gene IDL33915
Genebank Protein ID499894
General Reference
  • Poster, J. B., Dean, N. (1996). "The yeast VRG4 gene is required for normal Golgi functions and defines a new family of related genes." J Biol Chem 271:3837-3845.8632002
  • Kanik-Ennulat, C., Montalvo, E., Neff, N. (1995). "Sodium orthovanadate-resistant mutants of Saccharomyces cerevisiae show defects in Golgi-mediated protein glycosylation, sporulation and detergent resistance." Genetics 140:933-943.7672592
  • Rieger, M., Bruckner, M., Schafer, M., Muller-Auer, S. (1997). "Sequence analysis of 203 kilobases from Saccharomyces cerevisiae chromosome VII." Yeast 13:1077-1090.9290212
  • Tettelin, H., Agostoni Carbone, M. L., Albermann, K., Albers, M., Arroyo, J., Backes, U., Barreiros, T., Bertani, I., Bjourson, A. J., Bruckner, M., Bruschi, C. V., Carignani, G., Castagnoli, L., Cerdan, E., Clemente, M. L., Coblenz, A., Coglievina, M., Coissac, E., Defoor, E., Del Bino, S., Delius, H., Delneri, D., de Wergifosse, P., Dujon, B., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII." Nature 387:81-84.9169869
  • Kanik-Ennulat, C., Neff, N. (1990). "Vanadate-resistant mutants of Saccharomyces cerevisiae show alterations in protein phosphorylation and growth control." Mol Cell Biol 10:898-909.2137555
  • Ballou, L., Hitzeman, R. A., Lewis, M. S., Ballou, C. E. (1991). "Vanadate-resistant yeast mutants are defective in protein glycosylation." Proc Natl Acad Sci U S A 88:3209-3212.2014241
  • Dean, N. (1995). "Yeast glycosylation mutants are sensitive to aminoglycosides." Proc Natl Acad Sci U S A 92:1287-1291.7877969
  • Mondesert, G., Clarke, D. J., Reed, S. I. (1997). "Identification of genes controlling growth polarity in the budding yeast Saccharomyces cerevisiae: a possible role of N-glycosylation and involvement of the exocyst complex." Genetics 147:421-434.9335583
  • Manas, P., Olivero, I., Avalos, M., Hernandez, L. M. (1997). "Isolation of new nonconditional Saccharomyces cerevisiae mutants defective in asparagine-linked glycosylation." Glycobiology 7:487-497.9184829
  • Dean, N., Zhang, Y. B., Poster, J. B. (1997). "The VRG4 gene is required for GDP-mannose transport into the lumen of the Golgi in the yeast, Saccharomyces cerevisiae." J Biol Chem 272:31908-31914.9395539
  • Abe, M., Hashimoto, H., Yoda, K. (1999). "Molecular characterization of Vig4/Vrg4 GDP-mannose transporter of the yeast Saccharomyces cerevisiae." FEBS Lett 458:309-312.10570930
  • Gao, X. D., Nishikawa, A., Dean, N. (2001). "Identification of a conserved motif in the yeast golgi GDP-mannose transporter required for binding to nucleotide sugar." J Biol Chem 276:4424-4432.11067855
  • Hashimoto, H., Abe, M., Hirata, A., Noda, Y., Adachi, H., Yoda, K. (2002). "Progression of the stacked Golgi compartments in the yeast Saccharomyces cerevisiae by overproduction of GDP-mannose transporter." Yeast 19:1413-1424.12478588
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Abe, M., Noda, Y., Adachi, H., Yoda, K. (2004). "Localization of GDP-mannose transporter in the Golgi requires retrieval to the endoplasmic reticulum depending on its cytoplasmic tail and coatomer." J Cell Sci 117:5687-5696.15494368
  • Losev, E., Reinke, C. A., Jellen, J., Strongin, D. E., Bevis, B. J., Glick, B. S. (2006). "Golgi maturation visualized in living yeast." Nature 441:1002-1006.16699524
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258