You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameVacuolar amino acid transporter 6
SynonymsNot Available
Gene NameAVT6
Enzyme ClassNot Available
Biological Properties
General FunctionAmino acid transport and metabolism
Specific FunctionInvolved in amino acid efflux from the vacuole to the cytoplasm. Capable of transporting aspartate and glutamate. Requires ATP for function
Cellular LocationVacuole membrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00271L-Glutamic acidShow
YMDB00862hydronShow
YMDB00896L-Aspartic acidShow
GO ClassificationNot Available
Gene Properties
Chromosome Locationchromosome 5
LocusYER119C
Gene Sequence>1347 bp ATGGTAGCTAGTATTAGATCAGGTGTGCTGACACTTTTACACACGGCGTGCGGTGCTGGT ATCCTGGCCATGCCGTACGCATTCAAGCCGTTTGGATTAATTCCTGGAGTGATAATGATA GTGCTGTGTGGGGCGTGCGCTATGCAAAGCTTGTTCATACAAGCTCGTGTAGCTAAATAC GTACCACAGGGGAGGGCCTCGTTCAGTGCTCTGACGCGGTTGATTAACCCAAATCTAGGT ATTGTGTTTGACCTAGCGATCGCTATCAAGTGTTTTGGTGTGGGCGTCTCTTATATGATT GTAGTTGGGGATCTGATGCCCCAAATAATGTCTGTGTGGACCAGAAATGCTTGGCTGTTG AACAGGAACGTGCAAATTTCACTGATCATGCTTTTTTTCGTGGCCCCGCTGTCTTTTCTG AAGAAGTTGAATTCGTTGAGGTACGCTTCCATGGTGGCCATCTCTTCTGTAGCGTACTTG TGTGTTTTGGTGTTGTTGCACTATGTAGCACCATCAGATGAGATTCTTCGCTTGAAAGGC CGGATCTCCTACCTCCTGCCACCACAATCGCATGATTTGAACGTGCTAAACACTCTTCCA ATTTTTGTCTTTGCCTACACATGTCACCACAATATGTTTTCAATAATCAATGAGCAGAGG TCAAGCCGGTTCGAGCATGTGATGAAGATTCCACTGATAGCAATATCTTTGGCTCTCATC TTATATATTGCGATCGGCTGTGCTGGATACCTGACATTCGGCGACAACATCATTGGAAAC ATTATCATGCTGTACCCGCAAGCGGTCTCGAGCACCATCGGCAGAATAGCGATTGTGTTG TTGGTGATGCTGGCGTTCCCACTACAGTGTCATCCTGCAAGAGCTTCAATCCATCAGATT TTGCAACACTTCGCCGAGGAAAATGTAAGTATAAGTGCTACATCGGCGGATGAACCCACT GTTGCTACCGAAAGTTCTCCGTTGATTCGCGACAGTAGCCTTGACCTCAATGAGGTAATT GAAGAAGAATCTATTTATCAGCCTAAGGAGACTCCATTGAGAGGCAAGAGCTTTATTGTT ATAACGTGCAGCATTTTAGTTGCATCATATCTTGTCGCCATTTCGGTTTCCTCCTTGGCC CGTGTACTGGCCATTGTTGGGGCCACAGGCTCCACTTCTATTTCTTTCATTCTGCCCGGG CTCTTTGGCTACAAGCTTATAGGAACTGAGCACAAGACAGCCGTGCCATTGACGACAAAG ATTTTCAAATACACAGGTCTTCTCTTGTTTATCTGGGGGCTAATAATCATGATCACCTGC CTGACCGCAGCTTTGAAGCTAAACTAA
Protein Properties
Pfam Domain Function
Protein Residues448
Protein Molecular Weight48839.69922
Protein Theoretical pI8.92
Signalling Regions
  • None
Transmembrane Regions
  • 8-28
  • 33-53
  • 81-101
  • 126-146
  • 151-171
  • 196-216
  • 230-250
  • 268-288
  • 358-378
  • 382-402
  • 425-445
Protein Sequence>Vacuolar amino acid transporter 6 MVASIRSGVLTLLHTACGAGILAMPYAFKPFGLIPGVIMIVLCGACAMQSLFIQARVAKY VPQGRASFSALTRLINPNLGIVFDLAIAIKCFGVGVSYMIVVGDLMPQIMSVWTRNAWLL NRNVQISLIMLFFVAPLSFLKKLNSLRYASMVAISSVAYLCVLVLLHYVAPSDEILRLKG RISYLLPPQSHDLNVLNTLPIFVFAYTCHHNMFSIINEQRSSRFEHVMKIPLIAISLALI LYIAIGCAGYLTFGDNIIGNIIMLYPQAVSSTIGRIAIVLLVMLAFPLQCHPARASIHQI LQHFAEENVSISATSADEPTVATESSPLIRDSSLDLNEVIEEESIYQPKETPLRGKSFIV ITCSILVASYLVAISVSSLARVLAIVGATGSTSISFILPGLFGYKLIGTEHKTAVPLTTK IFKYTGLLLFIWGLIIMITCLTAALKLN
References
External Links
ResourceLink
Saccharomyces Genome Database AVT6
Uniprot IDP40074
Uniprot NameAVT6_YEAST
GenBank Gene IDU18916
Genebank Protein ID603358
General Reference
  • Dietrich, F. S., Mulligan, J., Hennessy, K., Yelton, M. A., Allen, E., Araujo, R., Aviles, E., Berno, A., Brennan, T., Carpenter, J., Chen, E., Cherry, J. M., Chung, E., Duncan, M., Guzman, E., Hartzell, G., Hunicke-Smith, S., Hyman, R. W., Kayser, A., Komp, C., Lashkari, D., Lew, H., Lin, D., Mosedale, D., Davis, R. W., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome V." Nature 387:78-81.9169868
  • Berroteran, R. W., Hampsey, M. (1995). "Sequence, map position and genome organization of the RPL17B gene, encoding ribosomal protein L17b in Saccharomyces cerevisiae." Yeast 11:761-766.7668045
  • Russnak, R., Konczal, D., McIntire, S. L. (2001). "A family of yeast proteins mediating bidirectional vacuolar amino acid transport." J Biol Chem 276:23849-23857.11274162
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956