You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameCarnitine O-acetyltransferase YAT2
SynonymsNot Available
Gene NameYAT2
Enzyme Class
Biological Properties
General FunctionInvolved in acyltransferase activity
Specific FunctionInvolved in the shutteling of acetyl-CoA in the cell
Cellular LocationCytoplasm
SMPDB Pathways
Fatty acid metabolismPW002460 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Fatty acid metabolismec00071 Map00071
SMPDB Reactions
Palmityl-CoA + (R)-CarnitineHexadecanoylcarnitine + Coenzyme A
KEGG Reactions
(R)-Carnitine + Acetyl-CoAO-acetylcarnitinium + Coenzyme A
Metabolites
YMDB IDNameView
YMDB00045Coenzyme AShow
YMDB00188L-CarnitineShow
YMDB00301Palmityl-CoAShow
YMDB00312Acetyl-CoAShow
YMDB00351L-AcetylcarnitineShow
YMDB00438S-Adenosyl-L-methionineShow
YMDB00616(R)-CarnitineShow
YMDB00617O-acetylcarnitiniumShow
YMDB01534HexadecanoylcarnitineShow
GO Classification
Component
Not Available
Function
transferase activity, transferring acyl groups
transferase activity, transferring acyl groups other than amino-acyl groups
acyltransferase activity
catalytic activity
transferase activity
Process
Not Available
Gene Properties
Chromosome Locationchromosome 5
LocusYER024W
Gene Sequence>2772 bp ATGTCAAGCGGCAGTACTATTGTTTCGTCTGACAAGTCGGGGCGAACATTTAAGCATGAG GAAGAACTACCCAAGTTACCATTACCTAAACTCTGTGACACTTTGCAGCGTCTGAAGGAG AGTTTAGAGCCATTGTATTATGCTGATGGTTACTATCAACATCCTTTAGATCCAGAACAA ATTGAGAAGCTGTCATCCATAATAAGAGATTTTGAAGAGAATCCCGTAAGTGAGAAGCTG CAATCTAAACTACAGAGCTACCATGACACTAGGGATTGCTACCTTGATGAATTACACTTA GACATCAATAACCAGACCTCCACTAGGGAGATTCAGGACGATGTCCTACCCAGGAATCCC TTCTTGGTTCTCGCAGATGACGCTTTGCCAAACATCACTCAAGCTGATAGGTCAGCCGTC CTAGTGCACTCTGCGGCCAGGTTTATTTCTGCTTTGAAACAAGATTTGTTGCCACCAGAT ATCAATGCCACCAATGGCAAACCACTGTCAATGGCTCCATTTCTGAACTTGTTCGGTACT ACTCGTAGTCCTGTTTTTCAGCGCGGTGAGGTTGAAAATTTTGATTTGAACAAACCTTAC ACAGCATCTGATTTAGAAGACCCTGATTATTCAAGCGATGAGGACGATAACGACGAACCC ACCCAAAAAGACTTTGATGACCGTAAAAGAAAACACGAAGAAGACATATTCACTGGCAAT GGTATAACTATAAAAAGACATCCGGATAGCAAACACATCTTGATCATCTCCAGGGGCCAA TACTATACACTGGAAGTACTTGATTCGACGAATAAAATTATATACACTGCTGCAGAATTA ACCACAATTTTCAACCATATAATAAAAGATTCTTCTGGCATTGAAAAATCAACTGCGTTA GGTAGTTTGACCTCTCACTCTTTTAGAAACTGGAAATATGCAAGGAAGAGACTACAGAAA AGGTATCCTAATGAATTACATCGCATAGACTCTGCTCTGTTCGTGTTAGTGCTGGACGAA TCACAAGAAGAAACTACCAATGATGGCGATGATACCGCTGATATCAGTCAAATGTTTAAC AGGACTATCACTGAGCGAGACAAGAAATGTACTTCCGCCAATTGTAAGAGAGTGTTTTAC GGTACTTCTATAATAAATAGCAAAGGCCATCAAGTGGGTTCATGTGTTTCTCGTTGGTAT GATAAATTACAGTTAGTTGTCACTGCAGATGCAAAAGCCACAGTGATTTGGGATTCCTTC ACATGTGACGGGTCAGTCGTGCTTCGGTTTACTTCTGAAATTTATACAGAATCAGTCTTG AGATTAGCTAGAGACGTTAACGCCGGTGACCCACAGTTTTCACTCTGGCCTAACGTGACA CAAATGGATCCTGAAACTAAAAAACTGATGACGGCGACCATAAGTGCCGACGGCGGAGGC CCTTCTGAAATTGACCCTAAGTTGGTTGTAAATAAAATCGATTGGTCTTTCAGTAACATC CTGAACACACATGTCCATTTGTCAGAAACCAAACTAGCTGATCTGATTTCCAAGTATGAT ATTGTTCGCGCTTCTATTCCATTGGGCAGAAGGTCAGCTCAAAGATTAGGAGTCAAGCCC GATTCGATGGTTCAAGTAGCTTTACAAATAGCTCACTATGCTTTGTATGGAAGAATGGTG TTTGGATTAGAACCAGTATCCACACGTGGTTTCAAAAACTCGAGATCATCTTTTATTAAC ATTCAAAGTCAAGCGCTGTTGGAACTATGTCAATTGTTTATTTCTAGCTCCATTGATGGG ACAGATAAATTAGACAAATTTATCCAAACCTGCGAAACACATAATAACATGGTTAAACAT GCAAAGTCTGGGGTAGGTTATGAAAAACACTTCAATGCATTGAAATATCTCTTCAAATTT CATGACCATTTTGGTATCCACTTAAGTGGTGATGAATCATCTGCTGCGAAAGATCTTTTC GAAAATCCACTTGTTTTACCTTTCTCACAGCCTGAGTTGATTGTTGCCAACTGTGGTAAT GCTGCTACCACGACATTTGGTATAACTCCTGCTGTACCTCATGGCTTTGGAATAGGGTAC ATCATTAAAGATGATCAAGTAGATTTGACCGTGACATCGCAATTTCGACAGGGTGACAGG TTAATGTTTATGTTAAGTTGGGTGTTAGGCGAAATTCGTTCCTACTGGAGGATGTCACGC GGCACTTCTCATAATAAAACTGGCGTGAAGATCAGTCCAGTGGTCGATAAATTGTATGAA ATGGACAATGCAGTCAATAATCCTCCGAAACGTAACGGCCATACAGTCAATGGCTCCCGC AAAACATCTTCTTCATCACAGGTAAATTTGAACAGGTATGGCGGGTTTTTCGATTTGGAA GGCCACATTGACAGTAGGAATATATCTAAAACACCATCGATGAAGAATTTGCAGAAAACC TTCAATGGCTTGACCATGAGCGCAGACAATGATCATTCAAGTTCCGCAGTTTCCGTTCCC ACAGAAAAGGAAAAATTAAATACAGGCCATGAAATTTTACAGATCCAACCGCGGGAAGTG GCAAGTAATGGGTTGGAAGCAGATGATGAGACAGATATTGAAATAGTTGCTGGCAATGCT GATGGCACATCCTCTTCGGCATCTTCAGCTACATCTCTAAATTCCAAGAAACGTAACGTC ATCAACTCAAGATTCGATATTGATTTTGACCGCAGTCGTGTGGGTAGAAAGGTGGCGACC TTAGATCAATAA
Protein Properties
Pfam Domain Function
Protein Residues923
Protein Molecular Weight103333.0
Protein Theoretical pI6.24
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Carnitine O-acetyltransferase YAT2 MSSGSTIVSSDKSGRTFKHEEELPKLPLPKLCDTLQRLKESLEPLYYADGYYQHPLDPEQ IEKLSSIIRDFEENPVSEKLQSKLQSYHDTRDCYLDELHLDINNQTSTREIQDDVLPRNP FLVLADDALPNITQADRSAVLVHSAARFISALKQDLLPPDINATNGKPLSMAPFLNLFGT TRSPVFQRGEVENFDLNKPYTASDLEDPDYSSDEDDNDEPTQKDFDDRKRKHEEDIFTGN GITIKRHPDSKHILIISRGQYYTLEVLDSTNKIIYTAAELTTIFNHIIKDSSGIEKSTAL GSLTSHSFRNWKYARKRLQKRYPNELHRIDSALFVLVLDESQEETTNDGDDTADISQMFN RTITERDKKCTSANCKRVFYGTSIINSKGHQVGSCVSRWYDKLQLVVTADAKATVIWDSF TCDGSVVLRFTSEIYTESVLRLARDVNAGDPQFSLWPNVTQMDPETKKLMTATISADGGG PSEIDPKLVVNKIDWSFSNILNTHVHLSETKLADLISKYDIVRASIPLGRRSAQRLGVKP DSMVQVALQIAHYALYGRMVFGLEPVSTRGFKNSRSSFINIQSQALLELCQLFISSSIDG TDKLDKFIQTCETHNNMVKHAKSGVGYEKHFNALKYLFKFHDHFGIHLSGDESSAAKDLF ENPLVLPFSQPELIVANCGNAATTTFGITPAVPHGFGIGYIIKDDQVDLTVTSQFRQGDR LMFMLSWVLGEIRSYWRMSRGTSHNKTGVKISPVVDKLYEMDNAVNNPPKRNGHTVNGSR KTSSSSQVNLNRYGGFFDLEGHIDSRNISKTPSMKNLQKTFNGLTMSADNDHSSSAVSVP TEKEKLNTGHEILQIQPREVASNGLEADDETDIEIVAGNADGTSSSASSATSLNSKKRNV INSRFDIDFDRSRVGRKVATLDQ
References
External Links
ResourceLink
Saccharomyces Genome Database YAT2
Uniprot IDP40017
Uniprot NameYAT2_YEAST
GenBank Gene IDU18778
Genebank Protein ID603616
General Reference
  • Dietrich, F. S., Mulligan, J., Hennessy, K., Yelton, M. A., Allen, E., Araujo, R., Aviles, E., Berno, A., Brennan, T., Carpenter, J., Chen, E., Cherry, J. M., Chung, E., Duncan, M., Guzman, E., Hartzell, G., Hunicke-Smith, S., Hyman, R. W., Kayser, A., Komp, C., Lashkari, D., Lew, H., Lin, D., Mosedale, D., Davis, R. W., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome V." Nature 387:78-81.9169868
  • Swiegers, J. H., Dippenaar, N., Pretorius, I. S., Bauer, F. F. (2001). "Carnitine-dependent metabolic activities in Saccharomyces cerevisiae: three carnitine acetyltransferases are essential in a carnitine-dependent strain." Yeast 18:585-595.11329169
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Franken, J., Kroppenstedt, S., Swiegers, J. H., Bauer, F. F. (2008). "Carnitine and carnitine acetyltransferases in the yeast Saccharomyces cerevisiae: a role for carnitine in stress protection." Curr Genet 53:347-360.18427809
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956