You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameProtoporphyrinogen oxidase
Synonyms
  • PPO
Gene NameHEM14
Enzyme Class
Biological Properties
General FunctionInvolved in oxygen-dependent protoporphyrinogen oxidase activity
Specific FunctionCatalyzes the 6-electron oxidation of protoporphyrinogen-IX to form protoporphyrin-IX
Cellular LocationMitochondrion inner membrane.
SMPDB Pathways
Porphyrin MetabolismPW002462 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Porphyrin and chlorophyll metabolismec00860 Map00860
SMPDB Reactions
Protoporphyrinogen IX + oxygenProtoporphyrin IX + Hydrogen peroxide
KEGG Reactions
oxygen + Protoporphyrinogen IXwater + Protoporphyrin IX
Metabolites
YMDB IDNameView
YMDB00055Protoporphyrin IXShow
YMDB00156Protoporphyrinogen IXShow
YMDB00888Hydrogen peroxideShow
YMDB00890waterShow
YMDB00900oxygenShow
GO Classification
Component
Not Available
Function
oxidoreductase activity
oxidoreductase activity, acting on the CH-CH group of donors, oxygen as acceptor
oxidoreductase activity, acting on the CH-CH group of donors
oxygen-dependent protoporphyrinogen oxidase activity
catalytic activity
Process
oxidation reduction
tetrapyrrole metabolic process
porphyrin metabolic process
porphyrin biosynthetic process
metabolic process
nitrogen compound metabolic process
Gene Properties
Chromosome Locationchromosome 5
LocusYER014W
Gene Sequence>1620 bp ATGTTATTACCATTAACAAAGCTAAAACCGAGAGCAAAAGTTGCTGTTGTAGGGGGTGGC GTTTCTGGACTATGTTTTACTTATTTTTTAAGCAAGTTGAGACCGGATGTTGAAATCACA CTGTTCGAATCGCAGAACAGAACTGGGGGTTGGATATATTCTTGTAACACAAGAGATATG AGTGGGAACCCAATTATGTTGGAGAAGGGACCCAGAACATTGAGGGGCGTATCAGACGGG ACCGTTCTGATTATGGATACCCTTAAAGACTTGGGCAAGGAAGCAGTTATTCAAAGCATT GATAAAGGTTGCATTGCAGACAAAAAGTTTCTACTAGACCCCAGTGATAAACTCGTGCAG GTTCCTAATTCGATATCTACAACAGTAAAATTTCTGCTGAATCCGTTGGGAAAAGGACTC ATCACGGGTATGATGGGAGAATGGTTCAGAAAAAAATCTCCACATCCTGGCCAAGACGAA AGTGTCGAATCCATTTGTGACAGAAGGTTTGGGAATAACTACATATCAAACAATATGATC AGTGCCTTACTAAGAGGTATCTATGGGGATGACGTTTCCCTATTAAGTGCCAAGAGAACG TTTAAGAAAATATACTACAATGAACTAAAGCACGGATCTAACACACAAGCTATGATTGAT AATATGCGCGGAAAGTCAAGAAGTAAAAAAACTGAGAACCTGCACCAATCTTTAACTGGC TGCCTTAACGACTACTCAAATGCGTTTGGAAAAGACAGGTCAAAGTTATTAGACTTATCC AACACGCTAAAGAAATATCCCATGTTGGGTCTTGCTGGGGGACTAGAAACGTTTCCCAAG ATAGTCAGAAATGCTTTGAACGAATTTAAAAACGTCAAAATAGTTACTGGGAACCCGGTT ACGCAAATAATGAAACGCCCTGCTAACGAAACGACAATCGGATTGAAAGCGAAATCTGGC GACCAATACGAAACATTTGACCATTTAAGACTTACGATAACACCTCCCAAAATCGCTAAA TTGCTACCGAAGGATCAAAATTCATTATCCAAGTTATTAGATGAGATACAATCAAACACA ATAATTTTAGTTAATTATTATTTGCCAAACAAAGATGTAATAGATGCCGATCTACAAGGC TTTGGATACTTGGTTCCCAAATCCAATAAGAATCCAGGGAAATTGCTTGGTGTAATTTTC GATTCTGTTATCGAAAGGAATTTCAAACCACTTTTTGACAAACTCTCCACAAACCCAAAC GCCCTCAACAAATATACAAAAGTGACTGCGATGATAGGAGGTTGTATGCTCAATGAACAC GGTGTTCCTGTAGTGCCATCCAGGGAGGTAACCATTAATGCAGTCAAAGATGCGCTGAAC AACCACCTCGGCATCAGTAACAAGGATCTGGAAGCTGGTCAGTGGGAATTCACTATCGCC GATAGATGTCTGCCAAGATTTCATGTAGGTTATGACGCATGGCAAGAAAGAGCTGAAAGG AAGTTGCAAGAATCTTACGGCCAAACAGTTTCTGTGGGGGGAATGGGATTTTCTAGAAGT CCCGGTGTCCCTGACGTTATTGTAGACGGCTTTAACGACGCCTTACAGCTAAGCAAATAA
Protein Properties
Pfam Domain FunctionNot Available
Protein Residues539
Protein Molecular Weight59702.39844
Protein Theoretical pI9.8
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Protoporphyrinogen oxidase MLLPLTKLKPRAKVAVVGGGVSGLCFTYFLSKLRPDVEITLFESQNRTGGWIYSCNTRDM SGNPIMLEKGPRTLRGVSDGTVLIMDTLKDLGKEAVIQSIDKGCIADKKFLLDPSDKLVQ VPNSISTTVKFLLNPLGKGLITGMMGEWFRKKSPHPGQDESVESICDRRFGNNYISNNMI SALLRGIYGDDVSLLSAKRTFKKIYYNELKHGSNTQAMIDNMRGKSRSKKTENLHQSLTG CLNDYSNAFGKDRSKLLDLSNTLKKYPMLGLAGGLETFPKIVRNALNEFKNVKIVTGNPV TQIMKRPANETTIGLKAKSGDQYETFDHLRLTITPPKIAKLLPKDQNSLSKLLDEIQSNT IILVNYYLPNKDVIDADLQGFGYLVPKSNKNPGKLLGVIFDSVIERNFKPLFDKLSTNPN ALNKYTKVTAMIGGCMLNEHGVPVVPSREVTINAVKDALNNHLGISNKDLEAGQWEFTIA DRCLPRFHVGYDAWQERAERKLQESYGQTVSVGGMGFSRSPGVPDVIVDGFNDALQLSK
References
External Links
ResourceLink
Saccharomyces Genome Database HEM14
Uniprot IDP40012
Uniprot NamePPOX_YEAST
GenBank Gene IDU18778
Genebank Protein ID603606
General Reference
  • Camadro, J. M., Labbe, P. (1996). "Cloning and characterization of the yeast HEM14 gene coding for protoporphyrinogen oxidase, the molecular target of diphenyl ether-type herbicides." J Biol Chem 271:9120-9128.8621563
  • Dietrich, F. S., Mulligan, J., Hennessy, K., Yelton, M. A., Allen, E., Araujo, R., Aviles, E., Berno, A., Brennan, T., Carpenter, J., Chen, E., Cherry, J. M., Chung, E., Duncan, M., Guzman, E., Hartzell, G., Hunicke-Smith, S., Hyman, R. W., Kayser, A., Komp, C., Lashkari, D., Lew, H., Lin, D., Mosedale, D., Davis, R. W., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome V." Nature 387:78-81.9169868
  • Camadro, J. M., Thome, F., Brouillet, N., Labbe, P. (1994). "Purification and properties of protoporphyrinogen oxidase from the yeast Saccharomyces cerevisiae. Mitochondrial location and evidence for a precursor form of the protein." J Biol Chem 269:32085-32091.7798202
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106