Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameGolgi apyrase
Synonyms
  • ATP-diphosphatase
  • ATP-diphosphohydrolase
  • Adenosine diphosphatase
  • ADPase
  • Golgi nucleoside diphosphatase
  • Yeast nucleoside diphosphatase 1
Gene NameYND1
Enzyme Class
Biological Properties
General FunctionInvolved in hydrolase activity
Specific FunctionCatalyzes the hydrolysis of phosphoanhydride bonds of nucleoside tri- and di-phosphates. Has equal high activity toward ADP/ATP, GDP/GTP, and UDP/UTP and approximately 50% less toward CDP/CTP and thiamine pyrophosphate. Has no activity toward GMP. Required for Golgi glycosylation and cell wall integrity. Together with CDC55, required for adenovirus E4orf4 (early region 4 open reading frame 4) induced toxicity, the apyrase activity is not required for this function. Plays a role in sphingolipid synthesis
Cellular LocationGolgi apparatus. Membrane; Single-pass membrane protein (Potential)
SMPDB Pathways
Pyrimidine metabolismPW002469 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Purine metabolismec00230 Map00230
Pyrimidine metabolismec00240 Map00240
SMPDB ReactionsNot Available
KEGG Reactions
water + Adenosine triphosphateAdenosine monophosphate + phosphate + hydron
water + GTPGuanosine monophosphate + phosphate + hydron
water + ADPAdenosine monophosphate + phosphate + hydron
water + Guanosine diphosphateGuanosine monophosphate + phosphate + hydron
Uridine 5'-diphosphate + waterphosphate + hydron + Uridine 5'-monophosphate
Metabolites
YMDB IDNameView
YMDB00049Uridine 5'-monophosphateShow
YMDB00097Adenosine monophosphateShow
YMDB00109Adenosine triphosphateShow
YMDB00257Guanosine diphosphateShow
YMDB00261Guanosine monophosphateShow
YMDB00307Uridine 5'-diphosphateShow
YMDB00326Uridine triphosphateShow
YMDB00558GTPShow
YMDB00862hydronShow
YMDB00890waterShow
YMDB00907phosphateShow
YMDB00914ADPShow
GO Classification
Component
Not Available
Function
catalytic activity
hydrolase activity
Process
Not Available
Gene Properties
Chromosome Locationchromosome 5
LocusYER005W
Gene Sequence>1890 bp ATGCTCATAGAAAACACTAATGATCGGTTTGGTATCGTCATAGATGCAGGGTCTTCGGGT TCGAGAATCCATGTGTTTAAGTGGCAGGACACGGAATCGCTTCTTCATGCAACAAACCAG GACTCACAGTCCATATTACAATCAGTACCTCATATTCATCAAGAAAAAGACTGGACTTTT AAGCTGAATCCAGGCTTGTCGAGTTTTGAAAAAAAACCTCAAGATGCGTACAAATCTCAC ATCAAGCCGTTACTAGATTTTGCTAAGAATATTATCCCTGAATCACATTGGTCGAGTTGT CCCGTTTTTATTCAAGCAACCGCGGGCATGCGCCTTTTACCTCAAGACATACAATCTTCC ATTTTGGATGGTTTGTGTCAGGGGCTCAAACACCCTGCAGAATTTTTGGTTGAGGATTGC TCAGCACAAATTCAAGTCATTGATGGTGAAACCGAAGGTTTATATGGCTGGCTTGGCTTA AACTATCTATATGGACACTTTAATGACTATAATCCAGAGGTCTCTGACCATTTTACATTT GGGTTTATGGACATGGGCGGTGCCTCTACTCAGATTGCGTTTGCACCGCATGATTCAGGA GAAATAGCTAGACATAGAGATGACATCGCCACCATCTTCTTGAGGAGTGTTAACGGAGAT TTGCAGAAATGGGACGTTTTTGTTAGTACGTGGTTAGGGTTTGGTGCCAATCAGGCTAGA AGAAGGTACTTGGCTCAGTTGATCAATACCCTTCCAGAAAACACAAATGATTACGAAAAT GATGACTTCTCTACAAGGAACTTGAATGATCCATGTATGCCGCGAGGAAGCAGCACGGAT TTTGAATTTAAAGATACCATATTTCACATCGCGGGTTCTGGGAATTACGAACAATGTACA AAATCTATTTATCCGTTACTTTTAAAGAACATGCCTTGTGATGACGAGCCGTGCTTGTTT AATGGTGTTCATGCTCCTCGAATAGACTTTGCCAATGACAAATTTATAGGTACTTCTGAG TACTGGTACACTGCCAACGACGTATTCAAACTTGGGGGCGAATACAACTTTGACAAATTT AGCAAAAGCCTAAGGGAGTTTTGCAATTCCAATTGGACGCAAATATTAGCGAACAGTGAT AAAGGCGTGTATAATTCTATTCCGGAGAATTTTTTGAAAGATGCATGCTTTAAGGGCAAT TGGGTCCTTAATATACTTCATGAAGGGTTTGATATGCCTCGAATAGATGTCGACGCAGAA AATGTCAATGACAGGCCCTTATTTCAAAGTGTGGAAAAAGTCGAAGAACGAGAGTTATCG TGGACACTAGGCAGAATTTTACTTTATGCCTCAGGTAGCATATTGGCAGGTAATGATGAC TTCATGGTGGGTATTGCGCCCAGTGAAAGAAGAACTAAGCTCACTGGTAAGAAATTCATA CCTGGCAAGTTACTGGAGTCTGATCAACTACGCAAGCAAAGTTCCAGCCTTTCTAATAAA GGATTTTTGATGTGGTTCGCAATTATTTGTTGCATATTTTACTTGATCTTTCATAGGTCA CACATAATCAGAAGACGTTTTTCCGGTCTGTACAACATTACCAAGGACTTTAAGACAGGC ATAAGGAGAAGGTTGAAATTTCTAAGGAGATCAGATCCATTTTCCAGATTGGAGGAAGGT GAACTTGGAACAGACGTAGATGGCTTCAAAGATGTGTACAGGATGAAGAGTAGCAGTATG TTTGATCTTGGTAAGAGTTCAGCCACAATGCAAAGGGAGCACGAACCACAAAGGACAGCA AGTCAGTCCGCTAATCTCGCTCCGTCAAACTTACGACCTGCGTTTTCTATGGCTGATTTT TCCAAATTTAAGGACAGTAGGCTATATGAT
Protein Properties
Pfam Domain Function
Protein Residues630
Protein Molecular Weight71851.20313
Protein Theoretical pI6.18
Signalling Regions
  • None
Transmembrane Regions
  • 501-517
Protein Sequence>Golgi apyrase MLIENTNDRFGIVIDAGSSGSRIHVFKWQDTESLLHATNQDSQSILQSVPHIHQEKDWTF KLNPGLSSFEKKPQDAYKSHIKPLLDFAKNIIPESHWSSCPVFIQATAGMRLLPQDIQSS ILDGLCQGLKHPAEFLVEDCSAQIQVIDGETEGLYGWLGLNYLYGHFNDYNPEVSDHFTF GFMDMGGASTQIAFAPHDSGEIARHRDDIATIFLRSVNGDLQKWDVFVSTWLGFGANQAR RRYLAQLINTLPENTNDYENDDFSTRNLNDPCMPRGSSTDFEFKDTIFHIAGSGNYEQCT KSIYPLLLKNMPCDDEPCLFNGVHAPRIDFANDKFIGTSEYWYTANDVFKLGGEYNFDKF SKSLREFCNSNWTQILANSDKGVYNSIPENFLKDACFKGNWVLNILHEGFDMPRIDVDAE NVNDRPLFQSVEKVEERELSWTLGRILLYASGSILAGNDDFMVGIAPSERRTKLTGKKFI PGKLLESDQLRKQSSSLSNKGFLMWFAIICCIFYLIFHRSHIIRRRFSGLYNITKDFKTG IRRRLKFLRRSDPFSRLEEGELGTDVDGFKDVYRMKSSSMFDLGKSSATMQREHEPQRTA SQSANLAPSNLRPAFSMADFSKFKDSRLYD
References
External Links
ResourceLink
Saccharomyces Genome Database YND1
Uniprot IDP40009
Uniprot NameYND1_YEAST
GenBank Gene IDAF203695
Genebank Protein ID6573161
General Reference
  • Gao, X. D., Kaigorodov, V., Jigami, Y. (1999). "YND1, a homologue of GDA1, encodes membrane-bound apyrase required for Golgi N- and O-glycosylation in Saccharomyces cerevisiae." J Biol Chem 274:21450-21456.10409709
  • Dietrich, F. S., Mulligan, J., Hennessy, K., Yelton, M. A., Allen, E., Araujo, R., Aviles, E., Berno, A., Brennan, T., Carpenter, J., Chen, E., Cherry, J. M., Chung, E., Duncan, M., Guzman, E., Hartzell, G., Hunicke-Smith, S., Hyman, R. W., Kayser, A., Komp, C., Lashkari, D., Lew, H., Lin, D., Mosedale, D., Davis, R. W., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome V." Nature 387:78-81.9169868
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Zhong, X., Malhotra, R., Guidotti, G. (2000). "Regulation of yeast ectoapyrase ynd1p activity by activator subunit Vma13p of vacuolar H+-ATPase." J Biol Chem 275:35592-35599.10954728
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Maoz, T., Koren, R., Ben-Ari, I., Kleinberger, T. (2005). "YND1 interacts with CDC55 and is a novel mediator of E4orf4-induced toxicity." J Biol Chem 280:41270-41277.16227198
  • Valachovic, M., Bareither, B. M., Shah Alam Bhuiyan, M., Eckstein, J., Barbuch, R., Balderes, D., Wilcox, L., Sturley, S. L., Dickson, R. C., Bard, M. (2006). "Cumulative mutations affecting sterol biosynthesis in the yeast Saccharomyces cerevisiae result in synthetic lethality that is suppressed by alterations in sphingolipid profiles." Genetics 173:1893-1908.16702413
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956