Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameEctonucleotide pyrophosphatase/phosphodiesterase 2
Synonyms
  • E-NPP 2
  • Alkaline phosphodiesterase 1
  • Nucleotide pyrophosphatase
  • NPPase
Gene NameNPP2
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionMediates extracellular nucleotide derived phosphate hydrolysis along with NPP1 and PHO5
Cellular LocationMembrane; Single-pass type II membrane protein (Potential)
SMPDB Pathways
Pantothenate and CoA biosynthesisPW002463 ThumbThumb?image type=greyscaleThumb?image type=simple
Riboflavin metabolismPW002443 ThumbThumb?image type=greyscaleThumb?image type=simple
Starch and sucrose metabolismPW002481 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Nicotinate and nicotinamide metabolismec00760 Map00760
Pantothenate and CoA biosynthesisec00770 Map00770
Purine metabolismec00230 Map00230
Riboflavin metabolismec00740 Map00740
Starch and sucrose metabolismec00500 Map00500
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00049Uridine 5'-monophosphateShow
YMDB00261Guanosine monophosphateShow
YMDB00288Glucose 1-phosphateShow
YMDB00386D-Mannose 1-phosphateShow
YMDB00415UDP-D-glucoseShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
catalytic activity
Process
metabolic process
Gene Properties
Chromosome Locationchromosome 5
LocusYEL016C
Gene Sequence>1482 bp ATGCTTCTTTTCGAGCAACCTGTTGACCTTGAAAAAAATAATGAAGATGATACGAACATA AAACCTTTCGCAATATCACGACATTTTTTATTGAAACTTTTGCTTTGCGGTATAATACTC ATTGAGTTGCTTTTATATTCGAAGTGCCCAAAACCTATTGATAATGGGCCCCGGACAATT GCGAATAGATCAAATACTTACTTCAACGGCACACATGATTTCAAGACGTTAACGATATTG ATATCTATCGATGGGTTCCATCCGAGATTGATAGATGCAAAATACACGCCATTTCTTTAC AACTTGCACAATTTGCGGTCCCCGTACGATATGAATATCACGACTGCACCGTATATGATC CCAAGTTTTCCCATTCAGACATTTCCCAACCACTGGAGCATGGTAACGGGAAAATATCCC ATTGAGCACGGTATTGTTTCCAATATATTCTGGGATAATTTCACGAGTAGCGAATTTAGA CCAAATAACCTCGACGCAAGAATTTGGAGCAACACGGCTGACCCTATTTGGCAACTACTG CAAACTGAATCGCAAGGCGAATATAAAGTGGCCACGCATATGTGGCCTGGAAGTGAGGTT GTGTATGAGGACCACGGGGATGTACCTAGGGAAAGAATGCCATTTTATTTTGGGAAATTC AATCAATGGGAAAAACTTCAAGATAAATTAGCTCAAATTTTCCGATACATAGATATGCCT CAGCTTAAAGATAGGCCAGAATTGGTCATAAGTTATATACCCAATGTTGATTCGTACGGA CACAGTTTTGGATACGATTTACGAGATAAGCGGCTACAAAAGCTGATCGGTGAAGTCGAT GGATTCTTTCTCGATTTGATTGAAGGCCTGCAAAAAAGAAACTTGTTGAAAATTAGCAAT GTTATGATTGTTAGTGACCATGGCATGAGCAATGTCAACGCGAATGACGGTGAGCATGTT GTTGTGTGGGAAAGGGTGTTCCCGGCCGACGCAATGAGCGCATTTATTTCGCATCTTTAT AACGAGGGCCCCATGATGATGGTATGTTTGAAAAACCCTCGAGACAAGCAATGGATTTGT GACTTGATTGAAGCTCAGTTAGAGAAAGCATATGGAGATGAAATATCGAGGAAGTTTCAC GTGATCCTGAAAGAAGATTTCGACCCGAGCTGGAAATATTTCCAATACGATAACAGAAAG CACAGATATGACGATAGGGTCGGCGATATCTGGATTCTCGCAGATGAATACTACGCCATT GTAAAAGAAATGGGTGATGTGCCTATCGGCATTATGGGCACACATGGATACAACTTTAAC AACTGTAGTGATATGGCATCTATATTCATTGGAATGGGTCCGATGTTCAACAATGAAGTC GTACCTCCATTTGAAAACATCGAAGTATACAATATGCTGATCAAGGCAAGTGCGCTTTTG GGAGAAGAAAAGACAAAGAAGGAGAAGAGTTTATTACAATAA
Protein Properties
Pfam Domain Function
Protein Residues493
Protein Molecular Weight57354.10156
Protein Theoretical pI5.46
Signalling Regions
  • None
Transmembrane Regions
  • 29-45
Protein Sequence>Ectonucleotide pyrophosphatase/phosphodiesterase 2 MLLFEQPVDLEKNNEDDTNIKPFAISRHFLLKLLLCGIILIELLLYSKCPKPIDNGPRTI ANRSNTYFNGTHDFKTLTILISIDGFHPRLIDAKYTPFLYNLHNLRSPYDMNITTAPYMI PSFPTQTFPNHWSMVTGKYPIEHGIVSNIFWDNFTSSEFRPNNLDARIWSNTADPIWQLL QTESQGEYKVATHMWPGSEVVYEDHGDVPRERMPFYFGKFNQWEKLQDKLAQIFRYIDMP QLKDRPELVISYIPNVDSYGHSFGYDLRDKRLQKLIGEVDGFFLDLIEGLQKRNLLKISN VMIVSDHGMSNVNANDGEHVVVWERVFPADAMSAFISHLYNEGPMMMVCLKNPRDKQWIC DLIEAQLEKAYGDEISRKFHVILKEDFDPSWKYFQYDNRKHRYDDRVGDIWILADEYYAI VKEMGDVPIGIMGTHGYNFNNCSDMASIFIGMGPMFNNEVVPPFENIEVYNMLIKASALL GEEKTKKEKSLLQ
References
External Links
ResourceLink
Saccharomyces Genome Database NPP2
Uniprot IDP39997
Uniprot NameNPP2_YEAST
GenBank Gene IDAY692687
Genebank Protein ID51012825
General Reference
  • Dietrich, F. S., Mulligan, J., Hennessy, K., Yelton, M. A., Allen, E., Araujo, R., Aviles, E., Berno, A., Brennan, T., Carpenter, J., Chen, E., Cherry, J. M., Chung, E., Duncan, M., Guzman, E., Hartzell, G., Hunicke-Smith, S., Hyman, R. W., Kayser, A., Komp, C., Lashkari, D., Lew, H., Lin, D., Mosedale, D., Davis, R. W., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome V." Nature 387:78-81.9169868
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Kennedy, E. J., Pillus, L., Ghosh, G. (2005). "Pho5p and newly identified nucleotide pyrophosphatases/ phosphodiesterases regulate extracellular nucleotide phosphate metabolism in Saccharomyces cerevisiae." Eukaryot Cell 4:1892-1901.16278456