Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePutative pyridoxal kinase BUD16
Synonyms
  • Bud site selection protein 16
Gene NameBUD16
Enzyme Class
Biological Properties
General FunctionInvolved in pyridoxal kinase activity
Specific FunctionRequired for synthesis of pyridoxal-5-phosphate from vitamin B6. Important for bud site selection
Cellular LocationCytoplasm. Nucleus
SMPDB PathwaysNot Available
KEGG Pathways
Vitamin B6 metabolismec00750 Map00750
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00109Adenosine triphosphateShow
YMDB00363Pyridoxal 5'-phosphateShow
YMDB00392PyridoxalShow
YMDB00914ADPShow
GO Classification
Component
Not Available
Function
pyridoxal kinase activity
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
Process
pyridoxine metabolic process
pyridoxine biosynthetic process
metabolic process
small molecule metabolic process
vitamin metabolic process
water-soluble vitamin metabolic process
vitamin B6 metabolic process
Gene Properties
Chromosome Locationchromosome 5
LocusYEL029C
Gene Sequence>939 bp ATGCCTCGTCTCTTGGCCACGCAGTCTCATGTTGTACATGGATATGTGGGAAATAAGGCT GCAACGTTTCCCTTACAGTGTCTAGGCTGGGATGTGGATTGTTGTAACAGTGTTCAGTTT TCCAACCATACCGGATATGGTTTAGATAAAGTGTTTGGGACTATAACGAGGGAAACAGAT TTGAAGGAACTCTTATCAGGTCTTTTTGATAATTTTTCCCAAGACTACCAAGCCTTACTT TCAGGCTACTTGCCCAATAAGAATTCCGTTCGATGTATGGGAACATACTACGCTAAATTT AAAGAGGCGAATCCAGAAATGATATGGCTTATGGATCCTGTTATGGGTGACGAAGGACAA TTATATGTTAGTGAGGATGTCATACCAGAATATAGAAAGCTGGCTTTGTCTCCAAAACAG CTAGTCGATATAATAACTCCGAATCAATTTGAGCTGGAGATACTTTATGGGGGGGAAATC AAGACTAAAGAACATTTGAAGAAGGCCTTAAAGAAATTACACCAAACTATCCCAGTGATC ATTGTCACATCCTGTGACTGTAAGATGTTTGATGACAAAGATTTTATTTATTGCGTAGCT TCAATGGAGGGTAAAACCCCCATTGTTTACAGAGTGCCGTTTATTGATTCGTATTTCACT GGGGTTGGTGATTTGTTTTCTGCTTTGTTATTGGATCGAGTGTATAAGATCTTATCGAAC CCTACAACAACATTAAAATTTGAAGACCAAGTCAATAATGTTCTTAATGTTATTCAGAAG GTTTTGAAAATTACTAGGAGCTATGCTTCAGGAAAAATGAAAGCAAAAATGGGTTCCGCC TTGGAAATGAAAGAAATGGAATTGCGTCTTATTGAATCAAGAGATATATATGAAACAATC AACATTCATCAAACAGATTATATTTACGCAAGGTTGTGA
Protein Properties
Pfam Domain Function
Protein Residues312
Protein Molecular Weight35558.89844
Protein Theoretical pI6.51
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Putative pyridoxal kinase BUD16 MPRLLATQSHVVHGYVGNKAATFPLQCLGWDVDCCNSVQFSNHTGYGLDKVFGTITRETD LKELLSGLFDNFSQDYQALLSGYLPNKNSVRCMGTYYAKFKEANPEMIWLMDPVMGDEGQ LYVSEDVIPEYRKLALSPKQLVDIITPNQFELEILYGGEIKTKEHLKKALKKLHQTIPVI IVTSCDCKMFDDKDFIYCVASMEGKTPIVYRVPFIDSYFTGVGDLFSALLLDRVYKILSN PTTTLKFEDQVNNVLNVIQKVLKITRSYASGKMKAKMGSALEMKEMELRLIESRDIYETI NIHQTDYIYARL
References
External Links
ResourceLink
Saccharomyces Genome Database BUD16
Uniprot IDP39988
Uniprot NameBUD16_YEAST
GenBank Gene IDU18530
Genebank Protein ID602396
General Reference
  • Dietrich, F. S., Mulligan, J., Hennessy, K., Yelton, M. A., Allen, E., Araujo, R., Aviles, E., Berno, A., Brennan, T., Carpenter, J., Chen, E., Cherry, J. M., Chung, E., Duncan, M., Guzman, E., Hartzell, G., Hunicke-Smith, S., Hyman, R. W., Kayser, A., Komp, C., Lashkari, D., Lew, H., Lin, D., Mosedale, D., Davis, R. W., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome V." Nature 387:78-81.9169868
  • Ni, L., Snyder, M. (2001). "A genomic study of the bipolar bud site selection pattern in Saccharomyces cerevisiae." Mol Biol Cell 12:2147-2170.11452010
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095