You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameN-acetyltransferase HPA3
SynonymsNot Available
Gene NameHPA3
Enzyme Class
Biological Properties
General FunctionInvolved in N-acetyltransferase activity
Specific FunctionN-acetyltransferase whose physiological acetyl acceptor substrate is still unknown. In vitro, histone acetylation is very weak
Cellular LocationCytoplasm. Nucleus
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00045Coenzyme AShow
YMDB00284D-SerineShow
YMDB00312Acetyl-CoAShow
YMDB00446propionyl-CoAShow
YMDB00794D-HistidineShow
YMDB00802D-ThreonineShow
YMDB00805D-TyrosineShow
YMDB00810N-Acetyl-DL-serineShow
YMDB00816D-MethionineShow
YMDB00820N-Acetyl-D-cysteineShow
YMDB00822D-2-aminopentanoic acidShow
YMDB00823N-acetyl-D-tryptophanShow
YMDB00829N-Acetyl-D-leucineShow
YMDB00833N-acetyl-D-prolineShow
YMDB00847D-CystineShow
YMDB00849D-AsparagineShow
YMDB00853D-IsoleucineShow
YMDB00855N-Acetyl-D-alanineShow
YMDB00860N-Acetyl-D-phenylalanineShow
YMDB00873N-Acetyl-D-valineShow
YMDB00903D-ProlineShow
YMDB00913D-CysteineShow
YMDB00990D-GlutamineShow
YMDB00991N-acetyl-D-methionineShow
YMDB00993D-AlanineShow
YMDB00995D-PhenylalanineShow
YMDB00996N-Acetyl-D-tyrosineShow
YMDB00997D-LeucineShow
YMDB00998D-TryptophanShow
YMDB01000D-ValineShow
YMDB01001NorleucineShow
GO Classification
Component
Not Available
Function
N-acetyltransferase activity
catalytic activity
transferase activity
transferase activity, transferring acyl groups
transferase activity, transferring acyl groups other than amino-acyl groups
acyltransferase activity
acetyltransferase activity
Process
metabolic process
Gene Properties
Chromosome Locationchromosome 5
LocusYEL066W
Gene Sequence>540 bp ATGAAAAAGACCCCAGACCCATCTCCACCTTTTGCAAGCACGAAGAACGTAGGCATGTCA AACGAAGAACCGGAAAAAATGGTTAACGATCGAATTGTGGTGAAGGCCATCGAGCCAAAA GATGAGGAAGCCTGGAACAAACTGTGGAAGGAGTATCAGGGTTTCCAAAAAACGGTTATG CCTCCGGAAGTAGCCACCACTACCTTCGCAAGGTTTATAGACCCTACGGTCAAACTATGG GGTGCTCTAGCCTTTGACACCGAGACCGGCGATGCAATTGGCTTTGCACACTACCTGAAC CATTTGACGTCGTGGCATGTCGAAGAAGTTGTCTACATGAATGACTTATATGTCACTGAA CGCGCAAGAGTCAAAGGCGTAGGTAGAAAGCTCATAGAATTTGTATACAGCCGTGCCGAT GAGCTCGGTACGCCTGCAGTGTACTGGGTTACAGACCATTACAATCACCGCGCACAGTTG CTGTACACCAAAGTGGCTTACAAGACAGATAAGGTTCTTTACAAGAGAAACGGATACTGA
Protein Properties
Pfam Domain Function
Protein Residues179
Protein Molecular Weight20698.5
Protein Theoretical pI7.84
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>N-acetyltransferase HPA3 MKKTPDPSPPFASTKNVGMSNEEPEKMVNDRIVVKAIEPKDEEAWNKLWKEYQGFQKTVM PPEVATTTFARFIDPTVKLWGALAFDTETGDAIGFAHYLNHLTSWHVEEVVYMNDLYVTE RARVKGVGRKLIEFVYSRADELGTPAVYWVTDHYNHRAQLLYTKVAYKTDKVLYKRNGY
References
External Links
ResourceLink
Saccharomyces Genome Database HPA3
Uniprot IDP39979
Uniprot NameHPA3_YEAST
GenBank Gene IDU18795
Genebank Protein ID603252
General Reference
  • Dietrich, F. S., Mulligan, J., Hennessy, K., Yelton, M. A., Allen, E., Araujo, R., Aviles, E., Berno, A., Brennan, T., Carpenter, J., Chen, E., Cherry, J. M., Chung, E., Duncan, M., Guzman, E., Hartzell, G., Hunicke-Smith, S., Hyman, R. W., Kayser, A., Komp, C., Lashkari, D., Lew, H., Lin, D., Mosedale, D., Davis, R. W., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome V." Nature 387:78-81.9169868
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Yow, G. Y., Uo, T., Yoshimura, T., Esaki, N. (2004). "D-amino acid N-acetyltransferase of Saccharomyces cerevisiae: a close homologue of histone acetyltransferase Hpa2p acting exclusively on free D-amino acids." Arch Microbiol 182:396-403.15375647
  • Angus-Hill, M. L., Dutnall, R. N., Tafrov, S. T., Sternglanz, R., Ramakrishnan, V. (1999). "Crystal structure of the histone acetyltransferase Hpa2: A tetrameric member of the Gcn5-related N-acetyltransferase superfamily." J Mol Biol 294:1311-1325.10600387