You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameD-lactate dehydrogenase [cytochrome] 3
Synonyms
  • D-lactate ferricytochrome C oxidoreductase
  • D-LCR
Gene NameDLD3
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific Function(R)-lactate + 2 ferricytochrome c = pyruvate + 2 ferrocytochrome c
Cellular LocationCytoplasm
SMPDB Pathways
Pyruvate metabolismPW002447 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Pyruvate metabolismec00620 Map00620
SMPDB Reactions
D-Lactic acid + ferricytochrome cPyruvic acid + Pentane + hydron
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00175Pyruvic acidShow
YMDB00287D-Lactic acidShow
YMDB00862hydronShow
YMDB16246PentaneShow
YMDB16255ferricytochrome cShow
GO Classification
Component
Not Available
Function
catalytic activity
binding
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
FAD or FADH2 binding
oxidoreductase activity
Process
Not Available
Gene Properties
Chromosome Locationchromosome 5
LocusYEL071W
Gene Sequence>1491 bp ATGACGGCCGCACATCCTGTTGCTCAGTTAACTGCCGAGGCATACCCTAAAGTCAAGAGA AACCCAAATTTCAAAGTTCTCGACTCGGAAGATTTGGCGTACTTTCGTTCGATTTTGTCA AATGATGAAATCTTAAACTCTCAAGCTCCAGAAGAGCTTGCTTCGTTTAACCAGGACTGG ATGAAAAAATATAGAGGCCAGTCCAATTTAATTCTCTTGCCAAACTCCACTGATAAAGTG TCCAAGATTATGAAATACTGTAACGATAAAAAGTTGGCAGTAGTACCACAAGGTGGTAAC ACCGACTTGGTCGGAGCCTCTGTTCCGGTATTTGATGAGATTGTTCTTTCTCTAAGAAAT ATGAACAAAGTCAGAGATTTTGATCCAGTTAGCGGGACTTTCAAGTGTGACGCGGGTGTC GTTATGCGTGATGCGCATCAATTTTTACACGACCATGACCATATCTTCCCATTGGATCTG CCTTCTAGAAACAACTGTCAAGTGGGCGGTGTAGTTTCAACAAATGCAGGTGGTTTGAAC TTTTTAAGATATGGGTCTCTACACGGTAATGTTTTGGGTTTGGAAGTGGTGCTACCCAAC GGTGAGATTATCAGCAATATCAATGCCCTAAGGAAGGACAATACTGGTTATGACTTGAAA CAATTATTCATCGGTGCAGAGGGTACTATCGGTGTCGTTACTGGTGTATCCATAGTTGCA GCAGCAAAGCCAAAAGCCTTGAATGCCGTATTTTTTGGTATTGAGAATTTCGATACCGTT CAGAAATTATTTGTCAAGGCTAAAAGTGAATTATCTGAGATTTTATCTGCTTTTGAATTC ATGGACCGTGGCTCCATTGAATGTACGATAGAATACTTGAAGGACTTGCCTTTCCCTCTG GAGAACCAACACAACTTTTATGTTCTTATTGAAACGTCAGGGTCCAATAAGAGACACGAC GATGAGAAGCTGACTGCTTTCCTCAAAGATACCACAGATTCTAAATTAATTTCGGAGGGT ATGATGGCTAAGGACAAAGCCGATTTTGATAGACTTTGGACCTGGAGAAAATCTGTTCCA ACAGCTTGTAATTCTTACGGTGGTATGTACAAGTATGACATGTCACTTCAATTGAAAGAT TTATATTCCGTATCTGCGGCTGTGACGGAGAGATTAAACGCAGCCGGTTTGATTGGTGAT GCACCAAAACCAGTTGTTAAATCATGTGGTTATGGTCATGTCGGTGACGGAAACATCCAT TTAAATATCGCGGTAAGAGAATTTACAAAACAGATTGAGGACTTACTAGAACCATTTGTT TATGAATATATTGCATCAAAGAAAGGTTCCATCAGTGCTGAGCATGGGATCGGTTTCCAT AAGAAAGGTAAGTTACACTACACCAGAAGTGATATTGAAATTAGATTTATGAAGGATATC AAAAATCACTACGATCCAAATGGAATCTTAAACCCATACAAGTACATTTGA
Protein Properties
Pfam Domain Function
Protein Residues496
Protein Molecular Weight55224.5
Protein Theoretical pI6.88
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>D-lactate dehydrogenase [cytochrome] 3 MTAAHPVAQLTAEAYPKVKRNPNFKVLDSEDLAYFRSILSNDEILNSQAPEELASFNQDW MKKYRGQSNLILLPNSTDKVSKIMKYCNDKKLAVVPQGGNTDLVGASVPVFDEIVLSLRN MNKVRDFDPVSGTFKCDAGVVMRDAHQFLHDHDHIFPLDLPSRNNCQVGGVVSTNAGGLN FLRYGSLHGNVLGLEVVLPNGEIISNINALRKDNTGYDLKQLFIGAEGTIGVVTGVSIVA AAKPKALNAVFFGIENFDTVQKLFVKAKSELSEILSAFEFMDRGSIECTIEYLKDLPFPL ENQHNFYVLIETSGSNKRHDDEKLTAFLKDTTDSKLISEGMMAKDKADFDRLWTWRKSVP TACNSYGGMYKYDMSLQLKDLYSVSAAVTERLNAAGLIGDAPKPVVKSCGYGHVGDGNIH LNIAVREFTKQIEDLLEPFVYEYIASKKGSISAEHGIGFHKKGKLHYTRSDIEIRFMKDI KNHYDPNGILNPYKYI
References
External Links
ResourceLink
Saccharomyces Genome Database DLD3
Uniprot IDP39976
Uniprot NameDLD3_YEAST
GenBank Gene IDU18795
Genebank Protein ID603247
General Reference
  • Dietrich, F. S., Mulligan, J., Hennessy, K., Yelton, M. A., Allen, E., Araujo, R., Aviles, E., Berno, A., Brennan, T., Carpenter, J., Chen, E., Cherry, J. M., Chung, E., Duncan, M., Guzman, E., Hartzell, G., Hunicke-Smith, S., Hyman, R. W., Kayser, A., Komp, C., Lashkari, D., Lew, H., Lin, D., Mosedale, D., Davis, R. W., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome V." Nature 387:78-81.9169868
  • Chelstowska, A., Liu, Z., Jia, Y., Amberg, D., Butow, R. A. (1999). "Signalling between mitochondria and the nucleus regulates the expression of a new D-lactate dehydrogenase activity in yeast." Yeast 15:1377-1391.10509019
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Peng, J., Schwartz, D., Elias, J. E., Thoreen, C. C., Cheng, D., Marsischky, G., Roelofs, J., Finley, D., Gygi, S. P. (2003). "A proteomics approach to understanding protein ubiquitination." Nat Biotechnol 21:921-926.12872131
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956