Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameProbable prolyl-tRNA synthetase, mitochondrial
Synonyms
  • Altered inheritance rate of mitochondria protein 10
  • Proline--tRNA ligase
  • ProRS
Gene NameAIM10
Enzyme Class
Biological Properties
General FunctionInvolved in nucleotide binding
Specific FunctionATP + L-proline + tRNA(Pro) = AMP + diphosphate + L-prolyl-tRNA(Pro)
Cellular LocationMitochondrion
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00097Adenosine monophosphateShow
YMDB00109Adenosine triphosphateShow
YMDB00219PyrophosphateShow
YMDB00378L-ProlineShow
GO Classification
Component
cell part
intracellular part
cytoplasm
Function
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
proline-tRNA ligase activity
adenyl ribonucleotide binding
ATP binding
ligase activity, forming carbon-oxygen bonds
ligase activity, forming aminoacyl-tRNA and related compounds
catalytic activity
aminoacyl-tRNA ligase activity
nucleotide binding
ligase activity
binding
Process
cellular macromolecule biosynthetic process
translation
prolyl-tRNA aminoacylation
metabolic process
macromolecule metabolic process
cellular macromolecule metabolic process
RNA metabolic process
ncRNA metabolic process
biosynthetic process
tRNA metabolic process
tRNA aminoacylation
tRNA aminoacylation for protein translation
macromolecule biosynthetic process
Gene Properties
Chromosome Locationchromosome 5
LocusYER087W
Gene Sequence>1731 bp ATGTCAGCTACTCTACTAAAGCAACCATTATGTACGGTTGTTCGGCAAGGTAAACAGTCC AAAGTGTCTGGATTGAACCTTTTGAGACTAAAGGCTCATTTGCACAGACAACACCTGTCA CCTTCCTTGATAAAACTACACTCTGAATTGAAATTGGATGAGCTGCAAACTGATAACACC CCTGATTACGTCCGTTTAGTTTTAAGGTCCTCTGTATACGATGTTATTAATGAATCTCCA ATCTCTCAAGGTGTAGGTTTGTCTTCCCGTCTAAACACGAATGTCATCTTGAAAAGAGAA GATCTATTGCCTGTTTTCTCTTTCAAGCTTCGTGGTGCCTATAACATGATTGCCAAGTTG GACGATTCTCAAAGAAACCAGGGTGTTATTGCCTGTTCAGCTGGGAATCATGCCCAAGGT GTGGCCTTTGCTGCTAAACACTTGAAAATACCTGCTACTATCGTTATGCCTGTTTGTACA CCATCTATTAAGTATCAAAATGTCTCGAGATTAGGGTCTCAAGTCGTCCTATATGGTAAC GATTTTGACGAGGCTAAGGCTGAATGTGCCAAATTGGCTGAAGAGCGTGGCTTGACGAAC ATTCCTCCTTTCGATCATCCTTATGTCATTGCCGGTCAAGGTACTGTAGCTATGGAAATC CTAAGACAAGTACGTACCGCTAATAAGATCGGTGCTGTCTTTGTTCCCGTCGGCGGTGGT GGTTTAATTGCTGGTATTGGTGCTTATTTGAAAAGGGTTGCTCCTCATATCAAAATCATT GGTGTTGAAACTTACGATGCGGCCACTTTACATAATTCCTTGCAACGCAACCAGAGAACT CCTTTACCTGTGGTGGGTACTTTTGCCGATGGTACGTCTGTGCGTATGATTGGTGAAGAA ACATTTAGAGTCGCCCAACAAGTGGTTGATGAAGTTGTTCTTGTTAACACTGACGAAATC TGTGCTGCAGTAAAGGATATTTTTGAAGATACTAGAAGTATTGTAGAACCATCTGGTGCC CTTTCAGTAGCCGGTATGAAGAAATACATCTCTACCGTACATCCAGAAATTGACCACACT AAAAACACCTATGTTCCCATCCTTTCTGGTGCTAACATGAACTTTGATAGATTAAGATTT GTTTCCGAACGTGCTGTTCTTGGTGAAGGAAAGGAAGTCTTCATGTTAGTTACTTTACCC GACGTCCCTGGTGCGTTCAAGAAAATGCAAAAGATCATCCACCCAAGATCTGTCACTGAA TTCTCTTACCGTTACAATGAACATCGTCATGAGTCCTCTAGTGAAGTGCCCAAGGCTTAC ATTTACACTTCTTTCAGCGTCGTTGACAGAGAAAAGGAAATCAAGCAAGTTATGCAACAG TTGAATGCTTTAGGTTTTGAAGCTGTGGATATCTCCGATAACGAATTGGCTAAATCTCAT GGTAGATACTTGGTTGGTGGTGCTTCTAAGGTTCCTAATGAAAGAATTATTTCATTTGAA TTCCCTGAAAGACCAGGTGCCTTGACTAGGTTCCTTGGAGGCCTAAGCGATTCTTGGAAT CTTACTTTATTCCATTATAGAAACCATGGTGCCGATATCGGTAAGGTTTTAGCTGGTATT TCCGTTCCTCCAAGGGAAAACTTAACCTTCCAAAAATTCTTGGAAGATTTAGGCTACACT TATCATGATGAAACTGATAACACTGTTTATCAAAAATTCTTGAAATATTAA
Protein Properties
Pfam Domain Function
Protein Residues576
Protein Molecular Weight65879.70313
Protein Theoretical pI7.45
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Probable prolyl-tRNA synthetase, mitochondrial MLKYRTLSRSCHIFHPKSLSNNTLKSETTQELLQTVGFVRRSQVGLFQWLPLGLRSLNKV SNAIRNRMDSDGGAIEVSLSAISSKALWQATDRWNNSELFKLKDSKGKQYCLTATCEEDI TDLMKNYIASYKDMPITIYQMTRKYRDEIRPRGGILRGREFLMKDAYSFASNEEDAFASF QKLDDTYNKIFKDLKIPFVSAWADSGDIGGEFSKEFHLIHESGEDTLMSCKHCGDISTLD MSQSYPEKDGQYSGDVDCKYALTKDHSTLICFYYPKDRQLNWNLALNAMDKDIDLTLRNK PNDHVLQVYEKDNEDIMFSKILRVMDCRLNSKSNFPDFPLKKYLKNNFGQISDVSIVDAQ ENEICGKCEEGRLEPLKSIEVGHIFLLGNKYSKPLNVKFVDKENKNETFVHMGCYGIGVS RLVGAIAELGRDSNGFRWPAIMAPYKVSICTGPNNPENSQRLQDVKSELLNDPTMQNLQN DILDQFNEKLGIGARIKLSHAMGIPLCVIVGSKSWPNVEIEVRGIRWGEKDLWRKQFEKR CSELQWKCTKNEHGIEKHTVPIQHLAEVIGVLLKDM
References
External Links
ResourceLink
Saccharomyces Genome Database AIM10
Uniprot IDP39965
Uniprot NameSYPM_YEAST
GenBank Gene IDU18839
Genebank Protein ID603324
General Reference
  • Dietrich, F. S., Mulligan, J., Hennessy, K., Yelton, M. A., Allen, E., Araujo, R., Aviles, E., Berno, A., Brennan, T., Carpenter, J., Chen, E., Cherry, J. M., Chung, E., Duncan, M., Guzman, E., Hartzell, G., Hunicke-Smith, S., Hyman, R. W., Kayser, A., Komp, C., Lashkari, D., Lew, H., Lin, D., Mosedale, D., Davis, R. W., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome V." Nature 387:78-81.9169868
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Reinders, J., Zahedi, R. P., Pfanner, N., Meisinger, C., Sickmann, A. (2006). "Toward the complete yeast mitochondrial proteome: multidimensional separation techniques for mitochondrial proteomics." J Proteome Res 5:1543-1554.16823961
  • Chi, A., Huttenhower, C., Geer, L. Y., Coon, J. J., Syka, J. E., Bai, D. L., Shabanowitz, J., Burke, D. J., Troyanskaya, O. G., Hunt, D. F. (2007). "Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry." Proc Natl Acad Sci U S A 104:2193-2198.17287358