You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameNuclear distribution protein PAC1
Synonyms
  • Lissencephaly-1 homolog
  • nudF homolog
  • LIS-1
Gene NamePAC1
Enzyme ClassNot Available
Biological Properties
General Functionpositive regulation of microtubule plus-end binding
Specific FunctionPositively regulates the activity of the minus-end directed microtubule motor protein dynein. Plays a central role in positioning the mitotic spindle at the bud neck during cell division. Targets cytoplasmic dynein to microtubule plus ends, thereby promoting dynein-mediated microtubule sliding along the bud cortex and consequently the movement of the mitotic spindle to the bud neck. Following plus end binding, dynein may be offloaded to the cortex by NUM1. Required for viability in the absence of the kinesin-related microtubule-dependent motor protein CIN8.
Cellular LocationNot Available
SMPDB Pathways
Ether lipid metabolismPW002492 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Ether lipid metabolismec00565 Map00565
SMPDB Reactions
Cytidine monophosphate + 2-O-acetyl-1-O-hexadecyl-sn-glycero-3-phosphocholineAcetic acid + hydron + Lyso-PAF C-16
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00056Acetic acidShow
YMDB00406Cytidine monophosphateShow
YMDB00862hydronShow
YMDB163282-O-acetyl-1-O-hexadecyl-sn-glycero-3-phosphocholineShow
YMDB16329Lyso-PAF C-16Show
GO Classification
Function
nucleus
cell division
identical protein binding
mitotic nuclear division
cytoplasmic microtubule
microtubule associated complex
spindle pole
microtubule plus-end binding
establishment of mitotic spindle orientation
nuclear migration along microtubule
positive regulation of ATP-dependent microtubule motor activity, plus-end-directed
positive regulation of microtubule plus-end binding
Gene Properties
Chromosome LocationNot Available
Locus
Gene Sequence>1485 bp ATGACTAACTGGCAGCAACAGCTTCCTTTAACAGATACACAGAAAAATGAACTCGATAAA AGTGTCCTCCGATATTTGAATTGGAATTACAAACAAACTGTACGACATGAGCATGCTCAA GATTACGAAAGTGTTCGACATGCAATTGTAACTCTATCAGGTTTTCTGTTGCAAGAATCA GTGGACCGGCAAGAATTCATCAGTAACAATGACACCAGTAACGAAAGTATGGTAGACATT GATGAATTACTGCTACCGAAGAAGTGGAACTCAATTGTTAGACTACAAAAAAAAATCATT GAATTGGAGCAGAATACAGAGACCCTTGTATCTCAGATTAAAGATTTGAACACTCAAGTG TCAGAACTAGCACAATTCAAACCTACCACCAGTAACGGCACCAGCGCACATAATGTTTTG AAATGGATACCGAGAAATCTACCAAGCTGTTTAATTAATGTTGAATCATCTGTCACTTCC GTCAAACTACATCCCAATTTGCCTATAGTGTTTGTGGCCACAGATCATGGCAAATTATAC GCATTTGATTTATTTAACTACACCATCCCTCTGGCATCCTTGCAAAGTCATACCAAGGCA ATTACCTCCATGGATGTTTTATTTACCAATTATACGAACTCCAGCAAGAAGAACTATTTG GTGATCGTTACCGCGTCTAAAGATTTGCAGATTCATGTTTTCAAGTGGGTCTCCGAGGAA TGCAAGTTCCAACAAATTAGGTCTTTATTGGGCCATGAGCATATTGTCTCTGCGGTAAAA ATCTGGCAGAAAAATAATGATGTCCATATAGCGTCCTGTTCCAGAGATCAAACTGTTAAA ATTTGGGACTTCCACAATGGTTGGTCGTTGAAAACATTTCAGCCTCATTCCCAATGGGTT CGTTCCATAGACGTTCTAGGCGATTACATCATCTCTGGTTCACATGACACTACATTAAGG TTAACACATTGGCCATCAGGTAATGGTCTTAGTGTTGGCACGGGTCATGAATTTCCCATA GAGAAAGTTAAATTTATTCATTTCATCGAAGACTCTCCGGAGATAAGGTTTAGAACACCA TCAACGGATCGATATAAGAATTGGGGGATGCAATATTGTGTCTCAGCGTCAAGAGATAGA ACGATAAAAATCTGGGAGATACCTCTACCTACGTTAATGGCCCATAGAGCACCCATACCG AATCCTACAGATTCAAATTTCAGATGTGTTCTTACGTTGAAGGGGCATCTTTCGTGGGTT AGAGATATTAGTATTCGAGGCCAATACTTGTTTTCTTGTGCTGATGATAAATCTGTCAGA TGTTGGGATCTGAACACGGGGCAGTGCTTACACGTTTGGGAAAAGTTGCATACAGGATTT GTCAACTGTTTAGACCTGGATGTGGATTTCGATTCTAACGTTACCCCAAGGCAAATGATG GTCACTGGTGGATTGGATTGCAAGTCTAACGTTTTCATGAGATAA
Protein Properties
Pfam Domain FunctionNot Available
Protein Residues494
Protein Molecular Weight56900.345
Protein Theoretical pINot Available
Signalling RegionsNot Available
Transmembrane RegionsNot Available
Protein Sequence>Nuclear distribution protein PAC1 MTNWQQQLPLTDTQKNELDKSVLRYLNWNYKQTVRHEHAQDYESVRHAIVTLSGFLLQES VDRQEFISNNDTSNESMVDIDELLLPKKWNSIVRLQKKIIELEQNTETLVSQIKDLNTQV SELAQFKPTTSNGTSAHNVLKWIPRNLPSCLINVESSVTSVKLHPNLPIVFVATDHGKLY AFDLFNYTIPLASLQSHTKAITSMDVLFTNYTNSSKKNYLVIVTASKDLQIHVFKWVSEE CKFQQIRSLLGHEHIVSAVKIWQKNNDVHIASCSRDQTVKIWDFHNGWSLKTFQPHSQWV RSIDVLGDYIISGSHDTTLRLTHWPSGNGLSVGTGHEFPIEKVKFIHFIEDSPEIRFRTP STDRYKNWGMQYCVSASRDRTIKIWEIPLPTLMAHRAPIPNPTDSNFRCVLTLKGHLSWV RDISIRGQYLFSCADDKSVRCWDLNTGQCLHVWEKLHTGFVNCLDLDVDFDSNVTPRQMM VTGGLDCKSNVFMR
References
External Links
ResourceLink
Saccharomyces Genome Database PAC1
Uniprot IDP39946
Uniprot NamePAC1
General ReferenceNot Available