You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameMannitol dehydrogenase DSF1
Synonyms
  • Deletion suppressor of MPT5 mutation protein 1
Gene NameDSF1
Enzyme Class
Biological Properties
General FunctionInvolved in oxidoreductase activity
Specific FunctionNot Available
Cellular LocationNot Available
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00110NADShow
YMDB00143NADHShow
YMDB00412NAD(+)Show
YMDB00657D-FructoseShow
YMDB00830D-mannitolShow
GO Classification
Component
Not Available
Function
binding
oxidoreductase activity
cofactor binding
coenzyme binding
catalytic activity
Process
oxidation reduction
metabolic process
Gene Properties
Chromosome Locationchromosome 5
LocusYEL070W
Gene Sequence>1509 bp ATGACAAAATCAGACGAAACAACAGCTACCAGCTTGAATGCTAAAACTCTAAAGAGTTTT GAATCAACTCTTCCAATACCAACTTACCCAAGAGAAGGTGTTAAACAAGGTATTGTTCAT CTGGGAGTCGGTGCATTCCACCGTTCCCATTTAGCTGTTTTCATGCACCGTCTGATGCAG GAGCACCACTTAAAGGACTGGTCCATATGTGGTGTTGGTTTAATGAAGGCAGATGCACTT ATGCGCGATGCCATGAAGGCCCAAGATTGCCTATACACCCTTGTGGAGCGTGGTATCAAG GACACTAACGCTTATATCGTCGGTTCCATTACTGCTTACATGTACGCTCCCGATGATCCA AGAGCTGTTATTGAAAAGATGGCCAATCCAGACACACACATTGTTTCTTTGACGGTCACA GAAAACGGTTACTACCACAGTGAAGCAACAAACTCCTTAATGACAGATGCTCCCGAGATT ATCAATGATTTGAACCACCCAGAAAAGCCAGATACTCTGTATGGGTACCTATATGAAGCC CTGTTGTTGCGTTACAAGAGAGGTCTTACCCCATTCACTATTATGTCATGTGACAACATG CCCCAAAATGGTGTCACAGTAAAGACCATGCTTGTTGCATTTGCCAAGTTAAAGAAGGAT GAGAAATTCGCCGCCTGGATTGAAGACAAGGTTACTTCTCCTAACAGCATGGTGGACCGT GTGACCCCACGTTGTACCGATAAAGAGCGTAAATACGTTGCTGACACCTGGGGAATCAAA GATCAATGTCCCGTTGTCGCAGAACCTTTCATCCAATGGGTTCTTGAAGACAACTTCTCC GATGGCCGTCCTCCATGGGAACTTGTTGGTGTTCAGGTCGTCAAGGATGTCGATTCCTAC GAATTGATGAAGTTGCGTCTACTTAACGGTGGACATTCTGCTATGGGATATTTGGGATAC TTGGCAGGCTACACCTATATACATGAGGTTGTCAACGACCCAACTATCAACAAGTATATC CGTGTTTTGATGCGTGAGGAAGTTATCCCATTATTGCCTAAAGTGCCAGGTGTTGATTTC GAAGAGTACACTGCATCAGTGTTGGAAAGATTCTCCAATCCAGCAATTCAGGACACTGTC GCACGTATTTGTTTGATGGGCTCTGGTAAGATGCCTAAGTATGTTTTGCCATCAATTTAC GAGCAGTTGCGTAAACCAGATGGTAAGTACAAGTTGTTGGCAGTATGTGTTGCTGGCTGG TTCCGTTACCTGACTGGTGTAGACATGAATGGGAAGCCATTCGAAATCGAGGATCCTATG GCACCAACCTTGAAGGCAGCCGCAGTTAAGGGCGGTAAAGATCCTCACGAACTGCTTAAC ATTGAGGTGCTTTTCAGTCCTGAGATTCGTGACAACAAAGAATTCGTTGCACAATTGACC CACTCCCTAGAAACAGTTTACGATAAAGGGCCAATTGCCGCTATTAAGGAAATTTTAGAC CAAGTGTGA
Protein Properties
Pfam Domain Function
Protein Residues502
Protein Molecular Weight56469.69922
Protein Theoretical pI6.07
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Mannitol dehydrogenase DSF1 MTKSDETTATSLNAKTLKSFESTLPIPTYPREGVKQGIVHLGVGAFHRSHLAVFMHRLMQ EHHLKDWSICGVGLMKADALMRDAMKAQDCLYTLVERGIKDTNAYIVGSITAYMYAPDDP RAVIEKMANPDTHIVSLTVTENGYYHSEATNSLMTDAPEIINDLNHPEKPDTLYGYLYEA LLLRYKRGLTPFTIMSCDNMPQNGVTVKTMLVAFAKLKKDEKFAAWIEDKVTSPNSMVDR VTPRCTDKERKYVADTWGIKDQCPVVAEPFIQWVLEDNFSDGRPPWELVGVQVVKDVDSY ELMKLRLLNGGHSAMGYLGYLAGYTYIHEVVNDPTINKYIRVLMREEVIPLLPKVPGVDF EEYTASVLERFSNPAIQDTVARICLMGSGKMPKYVLPSIYEQLRKPDGKYKLLAVCVAGW FRYLTGVDMNGKPFEIEDPMAPTLKAAAVKGGKDPHELLNIEVLFSPEIRDNKEFVAQLT HSLETVYDKGPIAAIKEILDQV
References
External Links
ResourceLink
Saccharomyces Genome Database DSF1
Uniprot IDP39941
Uniprot NameDSF1_YEAST
GenBank Gene IDU18795
Genebank Protein ID603248
General Reference
  • Dietrich, F. S., Mulligan, J., Hennessy, K., Yelton, M. A., Allen, E., Araujo, R., Aviles, E., Berno, A., Brennan, T., Carpenter, J., Chen, E., Cherry, J. M., Chung, E., Duncan, M., Guzman, E., Hartzell, G., Hunicke-Smith, S., Hyman, R. W., Kayser, A., Komp, C., Lashkari, D., Lew, H., Lin, D., Mosedale, D., Davis, R. W., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome V." Nature 387:78-81.9169868
  • Levesque, H., Lepingle, A., Nicaud, J. M., Gaillardin, C. (1996). "Sequencing of a 9.2 kb telomeric fragment from the right arm of Saccharomyces cerevisiae chromosome XIV." Yeast 12:289-295.8904342
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Philippsen, P., Kleine, K., Pohlmann, R., Dusterhoft, A., Hamberg, K., Hegemann, J. H., Obermaier, B., Urrestarazu, L. A., Aert, R., Albermann, K., Altmann, R., Andre, B., Baladron, V., Ballesta, J. P., Becam, A. M., Beinhauer, J., Boskovic, J., Buitrago, M. J., Bussereau, F., Coster, F., Crouzet, M., D'Angelo, M., Dal Pero, F., De Antoni, A., Del Rey, F., Doignon, F., Domdey, H., Dubois, E., Fiedler, T., Fleig, U., Floeth, M., Fritz, C., Gaillardin, C., Garcia-Cantalejo, J. M., Glansdorff, N. N., Goffeau, A., Gueldener, U., Herbert, C., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hinni, K., Iraqui Houssaini, I., Jacquet, M., Jimenez, A., Jonniaux, J. L., Karpfinger, L., Lanfranchi, G., Lepingle, A., Levesque, H., Lyck, R., Maftahi, M., Mallet, L., Maurer, K. C., Messenguy, F., Mewes, H. W., Mosti, D., Nasr, F., Nicaud, J. M., Niedenthal, R. K., Pandolfo, D., Pierard, A., Piravandi, E., Planta, R. J., Pohl, T. M., Purnelle, B., Rebischung, C., Remacha, M., Revuelta, J. L., Rinke, M., Saiz, J. E., Sartorello, F., Scherens, B., Sen-Gupta, M., Soler-Mira, A., Urbanus, J. H., Valle, G., Van Dyck, L., Verhasselt, P., Vierendeels, F., Vissers, S., Voet, M., Volckaert, G., Wach, A., Wambutt, R., Wedler, H., Zollner, A., Hani, J. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIV and its evolutionary implications." Nature 387:93-98.9169873
  • Ohkuni, K., Kikuchi, Y., Hara, K., Taneda, T., Hayashi, N., Kikuchi, A. (2006). "Suppressor analysis of the mpt5/htr1/uth4/puf5 deletion in Saccharomyces cerevisiae." Mol Genet Genomics 275:81-88.16328373