You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameSugar transporter STL1
SynonymsNot Available
Gene NameSTL1
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in transmembrane transporter activity
Specific FunctionNot Available
Cellular LocationMembrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00072D-GalactoseShow
YMDB00283GlycerolShow
YMDB00286D-GlucoseShow
YMDB00862hydronShow
GO Classification
Component
intrinsic to membrane
integral to membrane
cell part
membrane
membrane part
Function
transporter activity
transmembrane transporter activity
substrate-specific transmembrane transporter activity
Process
transmembrane transport
establishment of localization
transport
Gene Properties
Chromosome Locationchromosome 4
LocusYDR536W
Gene Sequence>1710 bp ATGAAGGATTTAAAATTATCGAATTTCAAAGGCAAATTTATAAGCAGAACCAGTCACTGG GGACTTACGGGTAAGAAGTTGCGGTATTTCATCACTATCGCATCTATGACGGGCTTCTCC CTGTTTGGATACGACCAAGGGTTGATGGCAAGTCTAATTACTGGTAAACAGTTCAACTAT GAATTTCCAGCAACCAAAGAAAATGGCGATCATGACAGACACGCAACTGTAGTGCAGGGC GCTACAACCTCCTGTTATGAATTAGGTTGTTTCGCAGGTTCTCTATTCGTTATGTTCTGC GGTGAAAGAATTGGTAGAAAACCATTAATCCTGATGGGTTCCGTAATAACCATCATTGGT GCCGTTATTTCTACATGCGCATTTCGTGGTTACTGGGCATTAGGCCAGTTTATCATCGGA AGAGTCGTCACCGGTGTTGGAACAGGGTTGAATACATCTACTATTCCCGTTTGGCAATCA GAAATGTCAAAAGCTGAAAATAGAGGGTTGCTGGTCAATTTAGAAGGTTCCACAATTGCT TTTGGTACTATGATTGCTTATTGGATTGATTTTGGGTTGTCTTATACCAACAGTTCTGTT CAGTGGAGATTCCCCGTGTCAATGCAAATCGTTTTTGCTCTCTTCCTGCTTGCTTTCATG ATTAAACTACCTGAATCGCCACGTTGGCTGATTTCTCAAAGTCGAACAGAAGAAGCTCGC TACTTGGTAGGAACACTAGACGACGCGGATCCAAATGATGAGGAAGTTATAACAGAAGTT GCTATGCTTCACGATGCTGTTAACAGGACCAAACACGAGAAACATTCACTGTCAAGTTTG TTCTCCAGAGGCAGGTCCCAAAATCTTCAGAGGGCTTTGATTGCAGCTTCAACGCAATTT TTCCAGCAATTTACTGGTTGTAACGCTGCCATATACTACTCTACTGTATTATTCAACAAA ACAATTAAATTAGACTATAGATTATCAATGATCATAGGTGGGGTCTTCGCAACAATCTAC GCCTTATCTACTATTGGTTCATTTTTTCTAATTGAAAAGCTAGGTAGACGTAAGCTGTTT TTATTAGGTGCCACAGGTCAAGCAGTTTCATTCACAATTACATTTGCATGCTTGGTCAAA GAAAATAAAGAAAACGCAAGAGGTGCTGCCGTCGGCTTATTTTTGTTCATTACATTCTTT GGTTTGTCTTTGCTATCATTACCATGGATATACCCACCAGAAATTGCATCAATGAAAGTT CGTGCATCAACAAACGCTTTCTCCACATGTACTAATTGGTTGTGTAACTTTGCGGTTGTC ATGTTCACCCCAATATTTATTGGACAGTCCGGTTGGGGTTGCTACTTATTTTTTGCTGTT ATGAATTATTTATACATTCCAGTTATCTTCTTTTTCTACCCTGAAACCGCCGGAAGAAGT TTGGAGGAAATCGACATCATCTTTGCTAAAGCATACGAGGATGGCACTCAACCATGGAGA GTTGCTAACCATTTGCCCAAGTTATCCCTACAAGAAGTCGAAGATCATGCCAATGCATTG GGCTCTTATGACGACGAAATGGAAAAAGAGGACTTTGGTGAAGATAGAGTAGAAGACACC TATAACCAAATTAACGGCGATAATTCGTCTAGTTCTTCAAACATCAAAAATGAAGATACA GTGAACGATAAAGCAAATTTTGAGGGTTGA
Protein Properties
Pfam Domain Function
Protein Residues569
Protein Molecular Weight63531.19922
Protein Theoretical pI6.51
Signalling Regions
  • None
Transmembrane Regions
  • 30-50
  • 80-100
  • 108-128
  • 130-150
  • 169-189
  • 204-224
  • 292-312
  • 331-351
  • 359-379
  • 390-410
  • 427-447
  • 454-474
Protein Sequence>Sugar transporter STL1 MKDLKLSNFKGKFISRTSHWGLTGKKLRYFITIASMTGFSLFGYDQGLMASLITGKQFNY EFPATKENGDHDRHATVVQGATTSCYELGCFAGSLFVMFCGERIGRKPLILMGSVITIIG AVISTCAFRGYWALGQFIIGRVVTGVGTGLNTSTIPVWQSEMSKAENRGLLVNLEGSTIA FGTMIAYWIDFGLSYTNSSVQWRFPVSMQIVFALFLLAFMIKLPESPRWLISQSRTEEAR YLVGTLDDADPNDEEVITEVAMLHDAVNRTKHEKHSLSSLFSRGRSQNLQRALIAASTQF FQQFTGCNAAIYYSTVLFNKTIKLDYRLSMIIGGVFATIYALSTIGSFFLIEKLGRRKLF LLGATGQAVSFTITFACLVKENKENARGAAVGLFLFITFFGLSLLSLPWIYPPEIASMKV RASTNAFSTCTNWLCNFAVVMFTPIFIGQSGWGCYLFFAVMNYLYIPVIFFFYPETAGRS LEEIDIIFAKAYEDGTQPWRVANHLPKLSLQEVEDHANALGSYDDEMEKEDFGEDRVEDT YNQINGDNSSSSSNIKNEDTVNDKANFEG
References
External Links
ResourceLink
Saccharomyces Genome Database STL1
Uniprot IDP39932
Uniprot NameSTL1_YEAST
GenBank Gene IDU33057
Genebank Protein ID927803
General Reference
  • Zhao, S., Douglas, N. W., Heine, M. J., Williams, G. M., Winther-Larsen, H. C., Meaden, P. G. (1994). "The STL1 gene of Saccharomyces cerevisiae is predicted to encode a sugar transporter-like protein." Gene 146:215-219.8076821
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258