You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameHexose transporter HXT13
SynonymsNot Available
Gene NameHXT13
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in transmembrane transporter activity
Specific FunctionProbable glucose transporter
Cellular LocationMembrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00286D-GlucoseShow
YMDB00657D-FructoseShow
YMDB00862hydronShow
YMDB00894D-MannoseShow
GO Classification
Component
cell part
membrane
membrane part
intrinsic to membrane
integral to membrane
Function
transmembrane transporter activity
substrate-specific transmembrane transporter activity
transporter activity
Process
transmembrane transport
establishment of localization
transport
Gene Properties
Chromosome Locationchromosome 5
LocusYEL069C
Gene Sequence>1695 bp ATGTCTAGTGCGCAATCCTCTATTGATAGCGATGGAGATGTTCGAGATGCTGATATTCAT GTCGCACCACCCGTGGAAAAAGAGTGGTCAGATGGATTTGATGACAACGAAGTCATAAAC GGGGATAACGTTGAGCCACCAAAAAGAGGGCTCATAGGTTATCTTGTCATTTACTTACTG TGTTATCCAATATCCTTTGGGGGTTTCCTGCCTGGTTGGGATAGTGGTATCACAGCAGGT TTCATTAACATGGACAACTTTAAAATGAACTTCGGTTCTTACAAGCATAGCACTGGTGAA TATTATTTGAGCAACGTGCGTATGGGTCTTCTTGTGGCTATGTTCAGTATTGGATGTGCC ATAGGTGGCCTTATTTTTGCCCGTCTTGCTGATACTTTAGGTAGAAGGCTGGCAATTGTG ATCGTGGTGTTGGTATATATGGTTGGTGCAATTATTCAGATCAGTTCAAATCACAAATGG TACCAGTACTTTGTCGGTAAGATCATCTACGGTCTTGGTGCTGGTGGCTGTTCGGTGTTG TGTCCAATGCTTTTGTCTGAAATAGCCCCCACAGATTTGAGAGGTGGACTGGTCTCATTG TACCAACTGAACATGACGTTCGGTATTTTCTTGGGTTATTGTAGCGTTTATGGTACGAGA AAATACGATAACACTGCACAATGGAGAGTCCCCCTTGGGCTTTGCTTTTTATGGGCTTTG ATTATCATCATTGGTATGTTATTGGTTCCAGAGTCCCCAAGATATCTGATTGAATGTGAG AGACACGAAGAGGCCCGTGCTTCCATTGCCAAAATCAACAAGGTTTCACCAGAGGATCCA TGGGTACTCAAACAGGCTGATGAAATCAACGCCGGTGTCCTTGCCCAAAGGGAACTAGGA GAAGCTTCATGGAAAGAACTTTTCTCTGTAAAAACTAAAGTCCTTCAACGTTTGATCACA GGTATTCTTGTGCAAACCTTTTTGCAACTTACTGGTGAAAACTACTTCTTCTTCTACGGA ACTACCATTTTTAAATCAGTCGGTCTTACTGATGGGTTTGAGACGTCGATCGTCCTAGGT ACAGTGAACTTCTTCTCCACTATTATTGCTGTTATGGTCGTAGACAAAATTGGCCGTCGT AAATGTCTGTTATTTGGTGCAGCTGGGATGATGGCTTGTATGGTCATATTTGCAAGTATC GGGGTGAAATGTCTTTACCCTCATGGCCAGGACGGTCCTTCTTCGAAAGGTGCAGGTAAT GCCATGATTGTGTTCACTTGTTTCTATATATTCTGCTTTGCAACGACATGGGCTCCTGTT GCTTATATTGTGGTTGCCGAGTCGTTCCCTTCGAAGGTCAAGTCTAGAGCCATGTCGATT TCAACTGCATGCAACTGGTTATGGCAATTTTTGATCGGTTTTTTCACACCATTCATTACT GGGTCTATCCACTTCTATTATGGTTATGTGTTCGTAGGTTGTTTGGTTGCTATGTTTTTG TACGTTTTCTTCTTTTTACCAGAAACGATTGGTCTATCTTTGGAGGAAATCCAATTACTA TACGAAGAAGGTATAAAACCATGGAAATCTGCATCTTGGGTCCCACCTTCTAGGAGAGGT ATTTCTTCCGAAGAAAGTAAGACCGAGAAGAAGGATTGGAAGAAATTTTTGAAGTTCTCA AAGAATTCTGATTGA
Protein Properties
Pfam Domain Function
Protein Residues564
Protein Molecular Weight62733.60156
Protein Theoretical pI7.28
Signalling Regions
  • None
Transmembrane Regions
  • 53-73
  • 110-130
  • 137-157
  • 168-188
  • 195-215
  • 230-250
  • 334-350
  • 357-374
  • 382-402
  • 425-445
  • 463-483
  • 485-505
Protein Sequence>Hexose transporter HXT13 MSSAQSSIDSDGDVRDADIHVAPPVEKEWSDGFDDNEVINGDNVEPPKRGLIGYLVIYLL CYPISFGGFLPGWDSGITAGFINMDNFKMNFGSYKHSTGEYYLSNVRMGLLVAMFSIGCA IGGLIFARLADTLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVL CPMLLSEIAPTDLRGGLVSLYQLNMTFGIFLGYCSVYGTRKYDNTAQWRVPLGLCFLWAL IIIIGMLLVPESPRYLIECERHEEARASIAKINKVSPEDPWVLKQADEINAGVLAQRELG EASWKELFSVKTKVLQRLITGILVQTFLQLTGENYFFFYGTTIFKSVGLTDGFETSIVLG TVNFFSTIIAVMVVDKIGRRKCLLFGAAGMMACMVIFASIGVKCLYPHGQDGPSSKGAGN AMIVFTCFYIFCFATTWAPVAYIVVAESFPSKVKSRAMSISTACNWLWQFLIGFFTPFIT GSIHFYYGYVFVGCLVAMFLYVFFFLPETIGLSLEEIQLLYEEGIKPWKSASWVPPSRRG ISSEESKTEKKDWKKFLKFSKNSD
References
External Links
ResourceLink
Saccharomyces Genome Database HXT13
Uniprot IDP39924
Uniprot NameHXT13_YEAST
GenBank Gene IDAY723801
Genebank Protein ID51830305
General Reference
  • Dietrich, F. S., Mulligan, J., Hennessy, K., Yelton, M. A., Allen, E., Araujo, R., Aviles, E., Berno, A., Brennan, T., Carpenter, J., Chen, E., Cherry, J. M., Chung, E., Duncan, M., Guzman, E., Hartzell, G., Hunicke-Smith, S., Hyman, R. W., Kayser, A., Komp, C., Lashkari, D., Lew, H., Lin, D., Mosedale, D., Davis, R. W., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome V." Nature 387:78-81.9169868
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258