You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NametRNA-splicing endonuclease subunit SEN34
Synonyms
  • Splicing endonuclease of 34 kDa
  • tRNA-intron endonuclease SEN34
Gene NameSEN34
Enzyme Class
Biological Properties
General FunctionInvolved in nucleic acid binding
Specific FunctionConstitutes one of the two catalytic subunit of the tRNA-splicing endonuclease complex, a complex responsible for identification and cleavage of the splice sites in pre-tRNA. It cleaves pre-tRNA at the 5'- and 3'-splice sites to release the intron. The products are an intron and two tRNA half-molecules bearing 2',3' cyclic phosphate and 5'-OH termini. There are no conserved sequences at the splice sites, but the intron is invariably located at the same site in the gene, placing the splice sites an invariant distance from the constant structural features of the tRNA body. It probably carries the active site for 3'-splice site cleavage
Cellular LocationNucleus. Endomembrane system; Peripheral membrane protein. Mitochondrion outer membrane; Peripheral membrane protein; Cytoplasmic side.
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00890waterShow
GO Classification
Component
tRNA-intron endonuclease complex
macromolecular complex
protein complex
Function
ribonuclease activity
catalytic activity
tRNA-specific ribonuclease activity
tRNA-intron endonuclease activity
binding
hydrolase activity
hydrolase activity, acting on ester bonds
nucleic acid binding
nuclease activity
Process
tRNA splicing, via endonucleolytic cleavage and ligation
metabolic process
macromolecule metabolic process
tRNA-type intron splice site recognition and cleavage
cellular macromolecule metabolic process
RNA metabolic process
RNA processing
RNA splicing
RNA splicing, via endonucleolytic cleavage and ligation
Gene Properties
Chromosome Locationchromosome 1
LocusYAR008W
Gene Sequence>828 bp ATGCCACCGCTAGTATTTGACATAGATCACATCAAACTTCTAAGGAAATGGGGTATTTGT GGTGTGTTATCTGGAACTTTGCCTACTGCAGCACAGCAAAATGTATTTTTGTCGGTACCT TTGAGGCTTATGTTAGAAGATGTGCTGTGGCTGCATTTGAACAATCTTGCCGATGTGAAA TTAATAAGACAAGAGGGAGATGAGATTATGGAGGGAATAACATTAGAGCGGGGCGCCAAA CTATCTAAAATTGTCAACGATCGTTTGAACAAGTCATTTGAATATCAGAGAAAGTTCAAA AAGGATGAACACATTGCAAAATTAAAGAAAATCGGTAGAATCAATGATAAAACCACAGCT GAAGAATTGCAACGGCTTGATAAATCTAGCAATAATGACCAGCTAATTGAATCTTCTTTG TTCATTGACATTGCTAATACCTCTATGATTTTAAGAGACATACGGAGTGATTCAGACAGC TTATCCCGCGATGATATCAGTGATTTGTTATTTAAGCAGTACAGACAGGCAGGAAAAATG CAGACCTATTTCTTATACAAGGCATTGAGAGATCAAGGGTACGTTTTGTCCCCAGGTGGA CGTTTTGGTGGGAAGTTTATAGCATACCCTGGTGATCCTCTTCGTTTCCATTCACATCTG ACGATACAAGATGCGATTGATTATCATAATGAGCCGATTGACCTAATATCCATGATAAGT GGTGCAAGACTAGGAACGACTGTGAAAAAACTTTGGGTCATAGGCGGTGTTGCGGAAGAG ACAAAGGAAACTCATTTCTTCTCAATAGAATGGGCTGGATTTGGTTAA
Protein Properties
Pfam Domain Function
Protein Residues275
Protein Molecular Weight31312.69922
Protein Theoretical pI7.79
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>tRNA-splicing endonuclease subunit SEN34 MPPLVFDIDHIKLLRKWGICGVLSGTLPTAAQQNVFLSVPLRLMLEDVLWLHLNNLADVK LIRQEGDEIMEGITLERGAKLSKIVNDRLNKSFEYQRKFKKDEHIAKLKKIGRINDKTTA EELQRLDKSSNNDQLIESSLFIDIANTSMILRDIRSDSDSLSRDDISDLLFKQYRQAGKM QTYFLYKALRDQGYVLSPGGRFGGKFIAYPGDPLRFHSHLTIQDAIDYHNEPIDLISMIS GARLGTTVKKLWVIGGVAEETKETHFFSIEWAGFG
References
External Links
ResourceLink
Saccharomyces Genome Database SEN34
Uniprot IDP39707
Uniprot NameSEN34_YEAST
GenBank Gene IDL22015
Genebank Protein ID349753
General Reference
  • Clark, M. W., Keng, T., Storms, R. K., Zhong, W., Fortin, N., Zeng, B., Delaney, S., Ouellette, B. F., Barton, A. B., Kaback, D. B., et, a. l. .. (1994). "Sequencing of chromosome I of Saccharomyces cerevisiae: analysis of the 42 kbp SPO7-CENI-CDC15 region." Yeast 10:535-541.7941740
  • Bussey, H., Kaback, D. B., Zhong, W., Vo, D. T., Clark, M. W., Fortin, N., Hall, J., Ouellette, B. F., Keng, T., Barton, A. B., et, a. l. .. (1995). "The nucleotide sequence of chromosome I from Saccharomyces cerevisiae." Proc Natl Acad Sci U S A 92:3809-3813.7731988
  • Trotta, C. R., Miao, F., Arn, E. A., Stevens, S. W., Ho, C. K., Rauhut, R., Abelson, J. N. (1997). "The yeast tRNA splicing endonuclease: a tetrameric enzyme with two active site subunits homologous to the archaeal tRNA endonucleases." Cell 89:849-858.9200603
  • Yoshihisa, T., Yunoki-Esaki, K., Ohshima, C., Tanaka, N., Endo, T. (2003). "Possibility of cytoplasmic pre-tRNA splicing: the yeast tRNA splicing endonuclease mainly localizes on the mitochondria." Mol Biol Cell 14:3266-3279.12925762