You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameProbable phospholipid-transporting ATPase DRS2
SynonymsNot Available
Gene NameDRS2
Enzyme Class
Biological Properties
General FunctionInvolved in nucleotide binding
Specific FunctionThis magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of phospholipids (Potential). Seems to be involved in ribosome assembly
Cellular LocationGolgi apparatus, trans-Golgi network membrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00109Adenosine triphosphateShow
YMDB00890waterShow
YMDB00907phosphateShow
YMDB00914ADPShow
GO Classification
Component
intrinsic to membrane
integral to membrane
cell part
membrane
membrane part
Function
ion binding
cation binding
metal ion binding
substrate-specific transporter activity
transporter activity
lipid transporter activity
transmembrane transporter activity
phospholipid transporter activity
phospholipid-translocating ATPase activity
hydrolase activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
magnesium ion binding
binding
ATPase activity, coupled to transmembrane movement of ions
catalytic activity
nucleoside binding
ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism
purine nucleoside binding
hydrolase activity, acting on acid anhydrides
adenyl nucleotide binding
hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances
adenyl ribonucleotide binding
ATP binding
Process
purine ribonucleoside triphosphate biosynthetic process
ATP biosynthetic process
nitrogen compound metabolic process
cellular nitrogen compound metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
establishment of localization
nucleobase, nucleoside and nucleotide metabolic process
transport
lipid transport
nucleoside phosphate metabolic process
phospholipid transport
nucleotide metabolic process
purine nucleotide metabolic process
purine nucleotide biosynthetic process
metabolic process
purine nucleoside triphosphate biosynthetic process
Gene Properties
Chromosome Locationchromosome 1
LocusYAL026C
Gene Sequence>4068 bp ATGAATGACGACAGAGAAACCCCCCCAAAGAGGAAACCTGGGGAGGACGACACGCTTTTC GATATTGACTTCTTAGACGACACGACTTCTCATTCTGGATCCCGTTCAAAGGTCACCAAC TCACATGCGAACGGATATTATATACCACCAAGTCATGTACTTCCCGAAGAGACTATCGAC TTAGACGCTGATGATGATAACATTGAAAATGATGTCCATGAAAATCTATTTATGAGCAAT AACCATGACGACCAAACGTCTTGGAATGCCAATAGATTCGACTCAGATGCATATCAACCA CAATCCCTACGAGCAGTCAAGCCTCCCGGTTTATTTGCTAGGTTTGGTAATGGTCTCAAA AATGCCTTTACGTTCAAACGGAAGAAAGGGCCCGAAAGTTTCGAAATGAATCATTACAAT GCGGTGACTAATAACGAATTAGACGATAATTATCTAGACTCGAGGAATAAGTTCAACATT AAAATTCTTTTCAACCGGTACATTTTAAGAAAGAACGTTGGCGACGCAGAGGGCAATGGT GAACCAAGAGTCATCCACATCAACGATTCTCTCGCTAATTCCTCCTTCGGTTATAGTGAC AACCATATATCTACCACCAAGTATAATTTTGCGACCTTTCTGCCTAAATTTTTGTTCCAA GAATTTTCCAAATACGCTAATCTGTTTTTTTTATGTACATCTGCCATTCAACAGGTGCCT CACGTCTCGCCAACTAATAGATACACCACAATTGGTACTTTATTAGTGGTTTTGATTGTT TCTGCCATGAAGGAATGTATCGAAGATATCAAGAGAGCTAATTCTGATAAAGAATTAAAT AATTCGACAGCAGAAATATTTTCAGAAGCACATGATGACTTTGTTGAGAAACGATGGATT GATATTCGTGTAGGTGACATAATTAGAGTAAAATCAGAGGAACCTATTCCTGCTGATACC ATAATTTTGTCATCTTCGGAACCGGAGGGTCTTTGCTACATTGAAACTGCCAACTTGGAT GGTGAAACAAATTTGAAAATCAAACAGTCGAGAGTAGAAACTGCCAAATTTATAGACGTT AAAACTTTGAAGAACATGAACGGAAAAGTTGTTTCCGAACAGCCGAACTCTAGCTTGTAT ACTTATGAAGGTACAATGACTTTAAATGATCGTCAAATACCGTTATCTCCTGACCAAATG ATTTTAAGAGGTGCAACTTTAAGAAATACTGCATGGATATTTGGTTTAGTTATCTTCACT GGTCATGAAACTAAGTTATTGCGTAATGCTACTGCAACCCCAATTAAAAGAACCGCGGTT GAGAAAATTATCAACAGACAGATTATTCGATTGTTCACAGTTTTAATCGTGCTAATTTTA ATTTCTTCAATTGGTAATGTTATTATGTCTACTGCAGATGCCAAACATTTATCGTACCTT TACCTGGAGGGTACCAACAAGGCTGGCTTATTCTTCAAAGACTTTTTAACATTTTGGATT CTATTTTCGAATCTAGTTCCTATTTCTCTATTTGTCACCGTTGAATTAATCAAATATTAT CAGGCTTTTATGATAGGTTCAGATCTAGATTTGTACTACGAAAAAACTGATACCCCAACT GTGGTTCGTACATCCTCTTTGGTTGAAGAACTTGGTCAAATAGAATATATATTCAGTGAC AAGACAGGAACTTTAACAAGAAATATTATGGAATTTAAATCCTGCTCTATTGCAGGCCAT TGCTATATTGATAAAATACCTGAAGATAAAACGGCCACTGTTGAAGATGGGATTGAAGTT GGTTATAGAAAATTTGACGATTTGAAGAAAAAGTTAAATGATCCCTCTGATGAGGATTCA CCTATTATCAATGACTTCTTAACATTACTGGCTACCTGTCATACTGTCATTCCAGAATTT CAAAGCGATGGATCTATTAAATATCAAGCAGCCTCTCCAGATGAAGGTGCCCTCGTTCAA GGTGGTGCAGATTTAGGGTATAAGTTTATCATCCGTAAAGGAAACTCTGTAACTGTTTTA TTGGAGGAAACTGGCGAGGAAAAAGAGTATCAACTACTTAACATTTGTGAATTTAATTCC ACCAGGAAGAGAATGAGCGCTATATTTAGATTTCCGGATGGTTCGATAAAGTTATTCTGT AAAGGTGCTGATACTGTCATTCTGGAAAGATTGGATGATGAAGCTAATCAATATGTAGAA GCTACAATGAGACATTTAGAAGATTATGCATCTGAGGGTTTGCGGACGTTGTGTTTGGCG ATGAGAGATATCTCTGAAGGAGAATATGAAGAATGGAATAGCATTTATAATGAGGCTGCC ACAACATTAGATAACAGAGCCGAGAAGCTAGACGAAGCCGCAAATCTAATCGAGAAAAAT CTAATATTAATTGGTGCAACTGCTATTGAAGATAAGTTACAGGACGGTGTTCCAGAAACT ATCCACACATTACAAGAAGCGGGTATTAAAATTTGGGTTTTAACTGGTGACAGACAGGAA ACTGCTATTAACATTGGTATGAGTTGCCGTTTATTGAGTGAAGACATGAATTTGTTGATC ATCAACGAGGAAACCAGAGATGATACTGAGAGAAATTTGTTAGAGAAGATTAACGCTCTA AACGAGCATCAATTGTCAACACATGATATGAAATCCTTAGCGCTCGTCATTGATGGGAAG TCATTAGGCTTTGCCTTGGAACCAGAATTAGAAGATTATTTGCTAACTGTGGCGAAGCTT TGTAAAGCGGTTATATGTTGCCGTGTATCTCCACTACAGAAAGCCTTGGTTGTTAAAATG GTAAAAAGAAAGTCGTCTTCACTACTGCTAGCCATTGCGAGTGGTGCCAACGATGTTAGT ATGATACAGGCAGCTCATGTTGGTGTCGGTATTAGTGGTATGGAAGGTATGCAAGCGGCT CGTTCAGCTGATATAGCTCTTGGCCAATTTAAATTTTTAAAAAAACTATTACTTGTCCAT GGCTCCTGGTCTTATCAAAGAATTTCTGTCGCAATTTTGTACTCTTTTTACAAGAATACA GCATTATACATGACGCAGTTTTGGTACGTTTTTGCCAATGCCTTTTCAGGTCAATCCATT ATGGAATCATGGACAATGAGTTTCTACAACTTATTCTTCACTGTTTGGCCCCCTTTTGTC ATTGGTGTATTTGATCAATTTGTTAGTAGTAGATTACTTGAGCGGTACCCACAATTGTAC AAATTAGGACAGAAGGGTCAATTTTTCTCTGTTTACATCTTCTGGGGATGGATTATTAAT GGCTTTTTCCATTCTGCAATAGTATTTATTGGCACCATATTGATTTACAGATATGGGTTT GCCTTAAATATGCACGGCGAACTAGCTGATCATTGGTCTTGGGGTGTAACTGTCTACACT ACAAGTGTCATTATTGTTTTGGGAAAGGCTGCTTTGGTAACTAATCAATGGACGAAATTC ACCTTAATTGCCATTCCTGGTTCCCTCTTATTTTGGTTAATATTCTTCCCAATTTATGCT TCTATATTTCCTCATGCTAACATCTCAAGAGAGTATTATGGTGTGGTTAAACACACGTAT GGATCCGGTGTATTTTGGTTAACTTTGATCGTTTTACCAATTTTTGCACTGGTAAGAGAT TTTCTATGGAAGTACTATAAAAGAATGTATGAACCAGAAACGTATCATGTTATTCAAGAA ATGCAGAAATACAATATCAGCGACTCTAGGCCGCACGTTCAGCAATTTCAAAATGCCATC AGGAAGGTGAGGCAAGTGCAAAGAATGAAAAAACAAAGAGGATTTGCCTTTTCACAGGCT GAAGAGGGTGGGCAAGAAAAAATTGTCAGAATGTATGATACTACTCAAAAGAGAGGTAAG TACGGTGAATTACAAGATGCTTCGGCGAACCCCTTTAATGACAATAATGGACTGGGAAGT AACGACTTTGAAAGTGCAGAACCGTTCATTGAAAATCCATTTGCTGATGGTAATCAAAAT TCAAATAGATTCAGTTCTTCGAGAGATGATATTTCATTTGATATATGA
Protein Properties
Pfam Domain Function
Protein Residues1355
Protein Molecular Weight153843.0
Protein Theoretical pI5.25
Signalling Regions
  • None
Transmembrane Regions
  • 222-242
  • 247-267
  • 450-470
  • 491-511
  • 1013-1033
  • 1044-1064
  • 1095-1115
  • 1132-1152
  • 1162-1182
  • 1203-1223
Protein Sequence>Probable phospholipid-transporting ATPase DRS2 MNDDRETPPKRKPGEDDTLFDIDFLDDTTSHSGSRSKVTNSHANGYYIPPSHVLPEETID LDADDDNIENDVHENLFMSNNHDDQTSWNANRFDSDAYQPQSLRAVKPPGLFARFGNGLK NAFTFKRKKGPESFEMNHYNAVTNNELDDNYLDSRNKFNIKILFNRYILRKNVGDAEGNG EPRVIHINDSLANSSFGYSDNHISTTKYNFATFLPKFLFQEFSKYANLFFLCTSAIQQVP HVSPTNRYTTIGTLLVVLIVSAMKECIEDIKRANSDKELNNSTAEIFSEAHDDFVEKRWI DIRVGDIIRVKSEEPIPADTIILSSSEPEGLCYIETANLDGETNLKIKQSRVETAKFIDV KTLKNMNGKVVSEQPNSSLYTYEGTMTLNDRQIPLSPDQMILRGATLRNTAWIFGLVIFT GHETKLLRNATATPIKRTAVEKIINRQIIRLFTVLIVLILISSIGNVIMSTADAKHLSYL YLEGTNKAGLFFKDFLTFWILFSNLVPISLFVTVELIKYYQAFMIGSDLDLYYEKTDTPT VVRTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGHCYIDKIPEDKTATVEDGIEV GYRKFDDLKKKLNDPSDEDSPIINDFLTLLATCHTVIPEFQSDGSIKYQAASPDEGALVQ GGADLGYKFIIRKGNSVTVLLEETGEEKEYQLLNICEFNSTRKRMSAIFRFPDGSIKLFC KGADTVILERLDDEANQYVEATMRHLEDYASEGLRTLCLAMRDISEGEYEEWNSIYNEAA TTLDNRAEKLDEAANLIEKNLILIGATAIEDKLQDGVPETIHTLQEAGIKIWVLTGDRQE TAINIGMSCRLLSEDMNLLIINEETRDDTERNLLEKINALNEHQLSTHDMKSLALVIDGK SLGFALEPELEDYLLTVAKLCKAVICCRVSPLQKALVVKMVKRKSSSLLLAIASGANDVS MIQAAHVGVGISGMEGMQAARSADIALGQFKFLKKLLLVHGSWSYQRISVAILYSFYKNT ALYMTQFWYVFANAFSGQSIMESWTMSFYNLFFTVWPPFVIGVFDQFVSSRLLERYPQLY KLGQKGQFFSVYIFWGWIINGFFHSAIVFIGTILIYRYGFALNMHGELADHWSWGVTVYT TSVIIVLGKAALVTNQWTKFTLIAIPGSLLFWLIFFPIYASIFPHANISREYYGVVKHTY GSGVFWLTLIVLPIFALVRDFLWKYYKRMYEPETYHVIQEMQKYNISDSRPHVQQFQNAI RKVRQVQRMKKQRGFAFSQAEEGGQEKIVRMYDTTQKRGKYGELQDASANPFNDNNGLGS NDFESAEPFIENPFADGNQNSNRFSSSRDDISFDI
References
External Links
ResourceLink
Saccharomyces Genome Database DRS2
Uniprot IDP39524
Uniprot NameATC3_YEAST
GenBank Gene IDL01795
Genebank Protein ID171114
General Reference
  • Ripmaster, T. L., Vaughn, G. P., Woolford, J. L. Jr (1993). "DRS1 to DRS7, novel genes required for ribosome assembly and function in Saccharomyces cerevisiae." Mol Cell Biol 13:7901-7912.8247005
  • Bussey, H., Kaback, D. B., Zhong, W., Vo, D. T., Clark, M. W., Fortin, N., Hall, J., Ouellette, B. F., Keng, T., Barton, A. B., et, a. l. .. (1995). "The nucleotide sequence of chromosome I from Saccharomyces cerevisiae." Proc Natl Acad Sci U S A 92:3809-3813.7731988
  • Gall, W. E., Geething, N. C., Hua, Z., Ingram, M. F., Liu, K., Chen, S. I., Graham, T. R. (2002). "Drs2p-dependent formation of exocytic clathrin-coated vesicles in vivo." Curr Biol 12:1623-1627.12372257
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Saito, K., Fujimura-Kamada, K., Furuta, N., Kato, U., Umeda, M., Tanaka, K. (2004). "Cdc50p, a protein required for polarized growth, associates with the Drs2p P-type ATPase implicated in phospholipid translocation in Saccharomyces cerevisiae." Mol Biol Cell 15:3418-3432.15090616
  • Gruhler, A., Olsen, J. V., Mohammed, S., Mortensen, P., Faergeman, N. J., Mann, M., Jensen, O. N. (2005). "Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway." Mol Cell Proteomics 4:310-327.15665377
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956