You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameLysophospholipase 1
Synonyms
  • Phospholipase B 1
Gene NamePLB1
Enzyme Class
Biological Properties
General FunctionInvolved in metabolic process
Specific FunctionSequentially removes both fatty acyl groups from diacylglycerophospholipids and therefore has both phospholipase A and lysophospholipase activities. Substrate preference is phosphatidylserine > phosphatidylinositol >> phosphatidylcholine > phosphatidylethanolamine
Cellular LocationCell membrane; Lipid-anchor, GPI-anchor (Probable)
SMPDB Pathways
Glycerophospholipid metabolismPW002493 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Glycerophospholipid metabolismec00564 Map00564
SMPDB ReactionsNot Available
KEGG Reactions
fatty acid + hydron + Glycerophosphocholinewater + phosphatidylcholine
Glycerylphosphorylethanolamine + fatty acid ↔ water + PE(14:0/16:1(9Z))
Metabolites
YMDB IDNameView
YMDB00309GlycerophosphocholineShow
YMDB00694sn-Glycero-3-phosphocholineShow
YMDB00757GlycerylphosphorylethanolamineShow
YMDB00862hydronShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
hydrolase activity
hydrolase activity, acting on ester bonds
lipase activity
phospholipase activity
catalytic activity
Process
metabolic process
organophosphate metabolic process
phospholipid metabolic process
phospholipid catabolic process
Gene Properties
Chromosome Locationchromosome 13
LocusYMR008C
Gene Sequence>1995 bp ATGAAGTTGCAGAGTTTGTTGGTTTCTGCTGCAGTTTTGACTTCTCTAACAGAGAACGTT AACGCTTGGTCACCAAATAACAGTTACGTCCCTGCGAACGTAACCTGTGATGATGATATT AACTTAGTCAGAGAAGCATCTGGTTTGTCAGATAACGAAACAGAATGGCTGAAAAAAAGA GATGCATACACCAAGGAGGCTTTGCATTCTTTTTTGAATAGGGCCACTTCGAATTTCAGT GACACTTCCTTGCTATCCACTCTTTTTGGTAGCAACCCTTCCAATATGCCTAAGATTGCC GTCGCCTGTTCTGGTGGTGGTTACCGTGCCATGTTGTCTGGTGCTGGTATGCTTGCTGCT ATGGACAATCGTACTGATGGCGCAAATGAGCATGGTCTTGGTGGGCTGCTGCAAGGTGCA ACTTACTTGGCAGGTCTGTCGGGTGGTAACTGGTTAACAAGTACTTTGGCTTGGAACAAC TGGACGTCTGTGCAAGCTATCGTGGATAATACAACAGAATCTAACTCAATTTGGGACATC TCTCATTCAATTCTTACCCCAGACGGCATTAACATCTTTAAGACTGGGAGTAGATGGGAC GACATATCAGATGACGTTCAGGATAAAAAAGACGCCGGTTTCAACATCTCTTTGGCGGAT GTTTGGGGCCGTGCTCTTGCGTACAATTTTTGGCCAAGCTTACACCGTGGTGGTGTAGGG TACACATGGTCAACTTTAAGGGAAGCTGATGTCTTCAAGAATGGAGAAATGCCCTTCCCT ATCACTGTTGCAGACGGTAGATACCCAGGTACCACCGTGATAAACTTGAATGCCACTCTT TTCGAATTTAATCCCTTTGAAATGGGTTCATGGGACCCCACTTTGAACGCATTTACGGAT GTGAAGTATTTAGGTACCAACGTTACAAACGGTAAACCAGTTAATAAAGGCCAATGCATT GCCGGGTTTGATAACACTGGTTTCATAACAGCCACTTCATCTACGTTGTTTAACCAATTT TTACTAAGATTGAATTCTACCGATTTACCTTCATTTATTGCTAACTTAGCCACCGATTTC CTGGAAGATTTATCCGACAATAGTGACGATATTGCAATTTACGCCCCAAATCCATTCAAG GAAGCTAATTTTCTTCAAAAGAACGCAACCTCCAGTATTATCGAATCAGAATATCTATTT TTGGTTGATGGTGGTGAAGATAACCAAAATATTCCTTTAGTTCCATTGTTGCAAAAGGAA CGTGAACTAGATGTTATTTTTGCATTAGACAATTCTGCTGATACTGACGACTATTGGCCA GATGGTGCTTCATTAGTTAACACTTATCAGCGTCAATTTGGCAGCCAAGGTCTCAATTTG TCTTTCCCATATGTTCCAGATGTGAACACATTTGTCAACTTGGGGTTGAACAAAAAGCCA ACCTTTTTTGGTTGTGATGCAAGAAATTTGACAGACTTGGAGTACATTCCACCATTAATT GTTTACATTCCAAATTCAAGACATTCATTTAATGGTAACCAAAGTACTTTTAAGATGTCA TACTCCGATTCAGAACGTCTTGGTATGATTAAGAATGGGTTTGAAGCTGCCACAATGGGT AATTTTACTGATGATTCTGATTTCTTGGGCTGTGTTGGTTGCGCCATTATCAGACGTAAG CAACAAAACTTGAATGCTACATTGCCCTCTGAATGCAGCCAGTGTTTTACCAACTACTGC TGGAACGGTACTATTGACAGCAGGTCAGTCTCAGGTGTAGGAAATGATGATTATTCTTCT TCTGCTTCCTTGTCTGCCTCCGCCGCTGCTGCCTCTGCCTCTGCCTCTGCCTCTGCTTCC GCCTCTGCCTCTGCTTCTGGGTCTTCCACTCATAAGAAAAATGCGGGCAATGCTTTGGTG AATTATTCTAACTTAAACACTAACACTTTTATTGGTGTCTTAAGTGTCATTAGTGCCGTC TTCGGTCTAATTTAG
Protein Properties
Pfam Domain Function
Protein Residues664
Protein Molecular Weight71666.60156
Protein Theoretical pI4.3
Signalling Regions
  • 1-22
Transmembrane Regions
  • None
Protein Sequence>Lysophospholipase 1 MKLQSLLVSAAVLTSLTENVNAWSPNNSYVPANVTCDDDINLVREASGLSDNETEWLKKR DAYTKEALHSFLNRATSNFSDTSLLSTLFGSNSSNMPKIAVACSGGGYRAMLSGAGMLAA MDNRTDGANEHGLGGLLQGATYLAGLSGGNWLTSTLAWNNWTSVQAIVDNTTESNSIWDI SHSILTPDGINIFKTGSRWDDISDDVQDKKDAGFNISLADVWGRALAYNFWPSLHRGGVG YTWSTLREADVFKNGEMPFPITVADGRYPGTTVINLNATLFEFNPFEMGSWDPTLNAFTD VKYLGTNVTNGKPVNKGQCIAGFDNTGFITATSSTLFNQFLLRLNSTDLPSFIANLATDF LEDLSDNSDDIAIYAPNPFKEANFLQKNATSSIIESEYLFLVDGGEDNQNIPLVPLLQKE RELDVIFALDNSADTDDYWPDGASLVNTYQRQFGSQGLNLSFPYVPDVNTFVNLGLNKKP TFFGCDARNLTDLEYIPPLIVYIPNSRHSFNGNQSTFKMSYSDSERLGMIKNGFEAATMG NFTDDSDFLGCVGCAIIRRKQQNLNATLPSECSQCFTNYCWNGTIDSRSVSGVGNDDYSS SASLSASAAAASASASASASASASASGSSTHKKNAGNALVNYSNLNTNTFIGVLSVISAV FGLI
References
External Links
ResourceLink
Saccharomyces Genome Database PLB1
Uniprot IDP39105
Uniprot NamePLB1_YEAST
GenBank Gene IDAY692788
Genebank Protein ID51013027
General Reference
  • Lee, K. S., Patton, J. L., Fido, M., Hines, L. K., Kohlwein, S. D., Paltauf, F., Henry, S. A., Levin, D. E. (1994). "The Saccharomyces cerevisiae PLB1 gene encodes a protein required for lysophospholipase and phospholipase B activity." J Biol Chem 269:19725-19730.8051052
  • Bowman, S., Churcher, C., Badcock, K., Brown, D., Chillingworth, T., Connor, R., Dedman, K., Devlin, K., Gentles, S., Hamlin, N., Hunt, S., Jagels, K., Lye, G., Moule, S., Odell, C., Pearson, D., Rajandream, M., Rice, P., Skelton, J., Walsh, S., Whitehead, S., Barrell, B. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII." Nature 387:90-93.9169872
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Hamada, K., Terashima, H., Arisawa, M., Yabuki, N., Kitada, K. (1999). "Amino acid residues in the omega-minus region participate in cellular localization of yeast glycosylphosphatidylinositol-attached proteins." J Bacteriol 181:3886-3889.10383953
  • Merkel, O., Fido, M., Mayr, J. A., Pruger, H., Raab, F., Zandonella, G., Kohlwein, S. D., Paltauf, F. (1999). "Characterization and function in vivo of two novel phospholipases B/lysophospholipases from Saccharomyces cerevisiae." J Biol Chem 274:28121-28127.10497163