Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePhosphatidylinositol 4-kinase PIK1
Synonyms
  • PI4-kinase
  • PtdIns-4-kinase
Gene NamePIK1
Enzyme Class
Biological Properties
General FunctionInvolved in binding
Specific FunctionActs on phosphatidylinositol (PI) in the first committed step in the production of the second messenger inositol-1,4,5,- trisphosphate. PIK1 is part of a nuclear phosphoinositide cycle and could control cytokinesis through the actin cytoskeleton
Cellular LocationNucleus
SMPDB Pathways
Inositol MetabolismPW002498 ThumbThumb?image type=greyscaleThumb?image type=simple
Inositol phosphate metabolismPW002495 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Inositol phosphate metabolismec00562 Map00562
SMPDB Reactions
1-Phosphatidyl-D-myo-inositol + Adenosine triphosphate1-Phosphatidyl-1D-myo-inositol 3-phosphate + ADP
1-phosphatidyl-1D-myo-inositol 4,5-biphosphate + Adenosine triphosphatePhosphatidylinositol-3,4,5-trisphosphate + ADP
Phosphatidylinositol-3,4,5-trisphosphate + ADP1-phosphatidyl-1D-myo-inositol 4,5-biphosphate + Adenosine triphosphate
KEGG Reactions
Adenosine triphosphate + 1-Phosphatidyl-D-myo-inositol + hydron ↔ 1-phosphatidyl-1D-myo-inositol 4-phosphate + ADP
Adenosine triphosphate + 1-Phosphatidyl-D-myo-inositol + hydron → 1-phosphatidyl-1D-myo-inositol 4-phosphate + ADP
Metabolites
YMDB IDNameView
YMDB00109Adenosine triphosphateShow
YMDB002301-Phosphatidyl-D-myo-inositolShow
YMDB00862hydronShow
YMDB00914ADPShow
YMDB161651-Phosphatidyl-1D-myo-inositol 3-phosphateShow
YMDB16180Phosphatidylinositol-3,4,5-trisphosphateShow
YMDB162511-phosphatidyl-1D-myo-inositol 4,5-biphosphateShow
GO Classification
Component
Not Available
Function
kinase activity
phosphotransferase activity, alcohol group as acceptor
inositol or phosphatidylinositol kinase activity
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
binding
Process
biological regulation
regulation of biological process
regulation of cellular process
signal transduction
organophosphate metabolic process
phospholipid metabolic process
intracellular signal transduction
second-messenger-mediated signaling
phosphoinositide-mediated signaling
metabolic process
glycerophospholipid metabolic process
phosphoinositide metabolic process
phosphoinositide phosphorylation
Gene Properties
Chromosome Locationchromosome 14
LocusYNL267W
Gene Sequence>3201 bp ATGCATAAAGCATCCAGTTCAAAGAAAAGCTTTGATGATACTATTGAACTAAAAAAAAAT GAACAATTACTGAAACTGATCAACTCTAGTGAATTCACCCTTCACAATTGTGTGGAGTTA CTGTGCAAACACTCCGAAAATATTGGTATACATTACTATTTATGTCAGAAATTGGCCACA TTTCCTCACAGCGAACTACAGTTCTATATTCCCCAACTAGTACAGGTCCTCGTCACCATG GAGACAGAATCAATGGCTTTAGAAGATTTACTATTAAGGTTGAGGGCGGAAAACCCTCAT TTTGCACTACTGACGTTTTGGCAGTTACAAGCGTTACTAACGGATTTATCTACTGACCCC GCTTCTTATGGCTTCCAAGTGGCTAGAAGAGTCTTAAACAACTTACAAACCAATCTCTTT AACACAAGTTCAGGTAGCGATAAAAATGTTAAAATACATGAAAACGTTGCACCGGCCTTA GTTCTTTCCTCTATGATAATGTCGGCTATAGCATTCCCCCAATTAAGCGAAGTGACCAAA CCATTAGTGGAATCTCAAGGTAGAAGACAAAAAGCTTTCGTTTTTAAGTTGGCTAGAAGT GCAATGAAAGATTTTACCAAGAACATGACCTTGAAAAATACCCTACTAAACAAGAAAACT TCCAGATCCAAAAGAGTTAGCTCAAATCGCAGTTCAACTCCGACTTCTCCAATAGATTTA ATAGATCCAATAAAAACTAAAGAAGATGCATCCTTCAGGAAATCCAGACATAGTGAGGTA AAATTGGATTTCGACATTGTGGATGATATAGGTAACCAGGTCTTTGAAGAAAGAATCTCA TCTTCAATCAAACTCCCAAAACGTAAACCTAAGTATTTGGATAATTCATACGTTCATAGG ACATATGATGGCAAAAATATAAACAGGGACGGAAGCATTTCAAATACCGCAAAGGCTCTC GATGGAAATAAAGGTGATTATATTTCTCCAAAGGGACGTAATGATGAAAATAATGAGATT GGTAACAATGAAGATGAAACTGGTGGTGAAACGGAGGAGGACGCGGACGCTTTAAACTCT GATCACTTCACCAGTTCTATGCCAGATCTGCATAATATTCAACCAAGGACTTCTTCTGCT TCATCTGCTTCTTTAGAAGGGACACCTAAGTTAAACAGGACCAATTCCCAACCCCTTTCG CGCCAGGCATTCAAAAACAGTAAAAAAGCGAATTCTTCTTTGAGTCAAGAAATTGACTTG TCGCAATTATCGACCACTTCAAAAATAAAAATGTTAAAAGCAAATTATTTTCGTTGCGAG ACACAATTTGCCATTGCGCTAGAAACAATATCTCAAAGGCTAGCTCGAGTACCGACAGAA GCTAGATTGAGTGCCTTACGAGCCGAGTTGTTTCTATTAAACAGGGACCTACCAGCGGAA GTAGATATCCCCACTTTATTGCCTCCAAATAAAAAAGGAAAGTTACATAAATTAGTGACC ATTACTGCTAATGAGGCACAAGTTTTGAACTCTGCAGAAAAAGTTCCATATTTACTCCTG ATAGAATACTTGAGAGACGAATTTGATTTTGACCCAACAAGTGAAACCAATGAAAGATTA TTAAAGAAGATCAGTGGTAATCAGGGAGGCTTGATATTTGATTTAAATTACATGAATAGA AAAGAAAACAACGAAAATAGAAATGAAAGTACTCTTACTAGCAACAACACTCGATCTTCG GTATATGATAGTAACTCGTTCAACAACGGGGCCTCCCGCAATGAAGGTCTATCCAGTACC TCAAGAAGTGATTCAGCGTCCACAGCTCATGTTAGGACTGAAGTCAATAAAGAGGAAGAT TTAGGTGATATGTCAATGGTAAAAGTCAGGAACAGAACGGATGACGAAGCGTATAGAAAT GCTTTAGTAATACAGAGTGCCGCAAATGTTCCAATTTTACCTGATGATAGTCAAGACAGA AGCCCAGAGTTGAACTTTGGCTCAAACTTGGACGAAGTACTCATCGAGAATGGAATTAAT AGCAAAAATATACATAGCCAAACTGACGCTTTAGCAGACCAGATGAGAGTTTCAGCTGTT ATGTTAGCACAATTGGATAAGTCGCCACAACAGTTATCAGAAAGTACCAAACAAATCCGC GCTCAAATTATTTCATCAATGAAGGAGGTGCAGGATAAATTTGGTTACCATGATTTGGAA GCCCTTCATGGAATGGCAGGTGAGAGAAAATTGGAAAACGATTTAATGACGGGTGGTATT GACACTTCATATCTAGGTGAAGATTGGGCTACCAAGAAAGAGAGGATACGTAAAACTTCG GAATATGGCCATTTCGAAAACTGGGATTTATGTTCTGTAATCGCCAAGACGGGTGATGAT TTGAGACAGGAGGCGTTTGCATACCAGATGATTCAAGCGATGGCCAATATTTGGGTTAAA GAAAAAGTTGACGTTTGGGTTAAAAGAATGAAAATTTTAATTACTAGTGCGAATACGGGA CTTGTGGAGACCATCACAAATGCTATGTCTGTGCATAGTATTAAAAAGGCTTTAACCAAA AAAATGATTGAAGATGCAGAACTAGATGACAAGGGTGGTATTGCCTCTTTGAATGATCAC TTCCTTAGAGCTTTTGGTAATCCTAATGGATTTAAGTATAGAAGAGCACAAGACAACTTT GCTTCTTCGTTAGCCGCATATTCTGTCATTTGCTATCTCTTGCAGGTTAAAGATAGACAC AACGGTAACATTATGATCGATAACGAAGGCCATGTAAGTCACATCGATTTTGGATTTATG CTATCAAATTCACCCGGCTCAGTGGGCTTTGAGGCCGCACCATTCAAATTAACTTACGAA TATATTGAACTGCTAGGCGGAGTAGAGGGAGAAGCGTTTAAAAAGTTTGTTGAACTAACT AAAAGTTCGTTCAAGGCTCTGAGAAAGTATGCTGATCAAATCGTATCAATGTGTGAGATT ATGCAAAAGGACAATATGCAGCCTTGTTTCGATGCTGGCGAACAAACAAGTGTACAACTA CGACAAAGGTTCCAATTGGACTTATCAGAAAAAGAAGTTGATGACTTCGTAGAAAATTTC TTGATAGGTAAATCTTTGGGTAGTATTTACACCAGAATATACGACCAATTTCAACTTATT ACACAGGGTATATATAGCTGA
Protein Properties
Pfam Domain Function
Protein Residues1066
Protein Molecular Weight119922.0
Protein Theoretical pI6.46
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Phosphatidylinositol 4-kinase PIK1 MHKASSSKKSFDDTIELKKNEQLLKLINSSEFTLHNCVELLCKHSENIGIHYYLCQKLAT FPHSELQFYIPQLVQVLVTMETESMALEDLLLRLRAENPHFALLTFWQLQALLTDLSTDP ASYGFQVARRVLNNLQTNLFNTSSGSDKNVKIHENVAPALVLSSMIMSAIAFPQLSEVTK PLVESQGRRQKAFVFKLARSAMKDFTKNMTLKNTLLNKKTSRSKRVSSNRSSTPTSPIDL IDPIKTKEDASFRKSRHSEVKLDFDIVDDIGNQVFEERISSSIKLPKRKPKYLDNSYVHR TYDGKNINRDGSISNTAKALDGNKGDYISPKGRNDENNEIGNNEDETGGETEEDADALNS DHFTSSMPDLHNIQPRTSSASSASLEGTPKLNRTNSQPLSRQAFKNSKKANSSLSQEIDL SQLSTTSKIKMLKANYFRCETQFAIALETISQRLARVPTEARLSALRAELFLLNRDLPAE VDIPTLLPPNKKGKLHKLVTITANEAQVLNSAEKVPYLLLIEYLRDEFDFDPTSETNERL LKKISGNQGGLIFDLNYMNRKENNENRNESTLTSNNTRSSVYDSNSFNNGASRNEGLSST SRSDSASTAHVRTEVNKEEDLGDMSMVKVRNRTDDEAYRNALVIQSAANVPILPDDSQDR SPELNFGSNLDEVLIENGINSKNIHSQTDALADQMRVSAVMLAQLDKSPQQLSESTKQIR AQIISSMKEVQDKFGYHDLEALHGMAGERKLENDLMTGGIDTSYLGEDWATKKERIRKTS EYGHFENWDLCSVIAKTGDDLRQEAFAYQMIQAMANIWVKEKVDVWVKRMKILITSANTG LVETITNAMSVHSIKKALTKKMIEDAELDDKGGIASLNDHFLRAFGNPNGFKYRRAQDNF ASSLAAYSVICYLLQVKDRHNGNIMIDNEGHVSHIDFGFMLSNSPGSVGFEAAPFKLTYE YIELLGGVEGEAFKKFVELTKSSFKALRKYADQIVSMCEIMQKDNMQPCFDAGEQTSVQL RQRFQLDLSEKEVDDFVENFLIGKSLGSIYTRIYDQFQLITQGIYS
References
External Links
ResourceLink
Saccharomyces Genome Database PIK1
Uniprot IDP39104
Uniprot NamePIK1_YEAST
GenBank Gene IDL20220
Genebank Protein ID432496
General Reference
  • Garcia-Bustos, J. F., Marini, F., Stevenson, I., Frei, C., Hall, M. N. (1994). "PIK1, an essential phosphatidylinositol 4-kinase associated with the yeast nucleus." EMBO J 13:2352-2361.8194527
  • Flanagan, C. A., Schnieders, E. A., Emerick, A. W., Kunisawa, R., Admon, A., Thorner, J. (1993). "Phosphatidylinositol 4-kinase: gene structure and requirement for yeast cell viability." Science 262:1444-1448.8248783
  • Sen-Gupta, M., Lyck, R., Fleig, U., Niedenthal, R. K., Hegemann, J. H. (1996). "The sequence of a 24,152 bp segment from the left arm of chromosome XIV from Saccharomyces cerevisiae between the BNI1 and the POL2 genes." Yeast 12:505-514.8740425
  • Philippsen, P., Kleine, K., Pohlmann, R., Dusterhoft, A., Hamberg, K., Hegemann, J. H., Obermaier, B., Urrestarazu, L. A., Aert, R., Albermann, K., Altmann, R., Andre, B., Baladron, V., Ballesta, J. P., Becam, A. M., Beinhauer, J., Boskovic, J., Buitrago, M. J., Bussereau, F., Coster, F., Crouzet, M., D'Angelo, M., Dal Pero, F., De Antoni, A., Del Rey, F., Doignon, F., Domdey, H., Dubois, E., Fiedler, T., Fleig, U., Floeth, M., Fritz, C., Gaillardin, C., Garcia-Cantalejo, J. M., Glansdorff, N. N., Goffeau, A., Gueldener, U., Herbert, C., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hinni, K., Iraqui Houssaini, I., Jacquet, M., Jimenez, A., Jonniaux, J. L., Karpfinger, L., Lanfranchi, G., Lepingle, A., Levesque, H., Lyck, R., Maftahi, M., Mallet, L., Maurer, K. C., Messenguy, F., Mewes, H. W., Mosti, D., Nasr, F., Nicaud, J. M., Niedenthal, R. K., Pandolfo, D., Pierard, A., Piravandi, E., Planta, R. J., Pohl, T. M., Purnelle, B., Rebischung, C., Remacha, M., Revuelta, J. L., Rinke, M., Saiz, J. E., Sartorello, F., Scherens, B., Sen-Gupta, M., Soler-Mira, A., Urbanus, J. H., Valle, G., Van Dyck, L., Verhasselt, P., Vierendeels, F., Vissers, S., Voet, M., Volckaert, G., Wach, A., Wambutt, R., Wedler, H., Zollner, A., Hani, J. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIV and its evolutionary implications." Nature 387:93-98.9169873
  • Hendricks, K. B., Wang, B. Q., Schnieders, E. A., Thorner, J. (1999). "Yeast homologue of neuronal frequenin is a regulator of phosphatidylinositol-4-OH kinase." Nat Cell Biol 1:234-241.10559922
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Gruhler, A., Olsen, J. V., Mohammed, S., Mortensen, P., Faergeman, N. J., Mann, M., Jensen, O. N. (2005). "Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway." Mol Cell Proteomics 4:310-327.15665377
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Chi, A., Huttenhower, C., Geer, L. Y., Coon, J. J., Syka, J. E., Bai, D. L., Shabanowitz, J., Burke, D. J., Troyanskaya, O. G., Hunt, D. F. (2007). "Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry." Proc Natl Acad Sci U S A 104:2193-2198.17287358
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956
  • Strahl, T., Huttner, I. G., Lusin, J. D., Osawa, M., King, D., Thorner, J., Ames, J. B. (2007). "Structural insights into activation of phosphatidylinositol 4-kinase (Pik1) by yeast frequenin (Frq1)." J Biol Chem 282:30949-30959.17720810