You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameProbable phosphatidylinositol-4-phosphate 5-kinase MSS4
Synonyms
  • 1-phosphatidylinositol-4-phosphate kinase
  • Diphosphoinositide kinase
  • PIP5K
Gene NameMSS4
Enzyme Class
Biological Properties
General FunctionInvolved in phosphatidylinositol phosphate kinase activity
Specific FunctionCatalyzes the phosphorylation of phosphatidylinositol-4- phosphate on the fifth hydroxyl of the myo-inositol ring, to form phosphatidylinositol-4,5-biphosphate. Acts downstream of STT4, but in a pathway that does not involve PKC1. May be involved in the organization of the actin cytoskeleton
Cellular LocationNot Available
SMPDB Pathways
Inositol phosphate metabolismPW002495 ThumbThumb?image type=greyscaleThumb?image type=simple
Stress-activated signalling pathways: cell wall stress test 1PW007861 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Inositol phosphate metabolismec00562 Map00562
SMPDB Reactions
PIP(18:0/20:4(5Z,8Z,11Z,14Z)) + phosphatePIP2(18:0/20:4(5Z,8Z,11Z,14Z))
KEGG Reactions
Adenosine triphosphate + 1-phosphatidyl-1D-myo-inositol 4-phosphate + hydronADP + 1D-myo-inositol 4,5-bisphosphate
Adenosine triphosphate + 1-phosphatidyl-1D-myo-inositol 4-phosphate → ADP + 1D-myo-inositol 4,5-bisphosphate
Metabolites
YMDB IDNameView
YMDB00109Adenosine triphosphateShow
YMDB00862hydronShow
YMDB00907phosphateShow
YMDB00914ADPShow
YMDB16197PIP(18:0/20:4(5Z,8Z,11Z,14Z))Show
YMDB16198PIP2(18:0/20:4(5Z,8Z,11Z,14Z))Show
GO Classification
Component
Not Available
Function
transferase activity, transferring phosphorus-containing groups
kinase activity
lipid kinase activity
phosphatidylinositol phosphate kinase activity
catalytic activity
transferase activity
Process
organophosphate metabolic process
phospholipid metabolic process
glycerophospholipid metabolic process
phosphoinositide metabolic process
phosphatidylinositol metabolic process
metabolic process
Gene Properties
Chromosome Locationchromosome 4
LocusYDR208W
Gene Sequence>2340 bp ATGTCAGTCTTGCGATCACAACCTCCTTCAGTTGTACCGCTACATCTGACAACATCCACC AGTCGCAAAACAGAACAGGAACCATCGCTATTGCACTCTGCAATAATTGAGCGACATCAA GACCGTTCGGTGCCGAATTCGAATTCGAATCCGGATTCGAACCATCGAATAAAAAAGGAT CGCAATAATCACACTAGCTACCATTCTTCATCGAATTCGGAGTCAAACATGGAAAGTCCT CGCTTGTCAGATGGTGAGTCTTCCACTCCGACCTCTATTGAAGAGTTAAACCCAACAATA AATAATTCGAGGCTGGTGAAGAGAAACTACTCAATATCAATTGATCCTTTGCATGACAAC AGCAATAATAATACGGATGATGATCATCCAAACACCATAACTTCTCCCCGACCAAATAGC ACTAGTAACAAGGAAATGCAGAAATATAGTTTTCCCGAAGGTAAGGAGTCGAAGAAAATA ACAACACCCTCGTTAAACTCGAATAATTGTTTGGATTTGGACAATTCCAGTCTTGTTCAC ACAGATTCGTATATACAAGACTTAAATGACGATCATATTTTACTAAACAAGCGCGTTTCG AGGCGATCTTCCAGAATATCGGCAGTAACAGCAACTTCCACGACAATTAAGCAAAGAAGA AATACTCAGGATTCAAACCTGCCCAATATTCCCTTTCACGCTTCCAAGCATTCTCAAATT CTACCTATGGATGATTCAGATGTAATAAAATTGGCCAATGGAGATACCAGCATGAAACCA AATTCTGCTACTAAAATTAGTCACTCAATGACTTCTTTGCCTCTTCACCCACTTCCACAA CCTTCTCAAAAGTCAAAGCAATATCATATGATATCCAAATCAACCACTTCTTTGCCGCCA GAGAATGACCACTACTATCAACACAGTCGTGGCACCAACCATAATCACGCTGCTAATGCT GCTGCTGTTAATAATAATACTACTACTACTACCGCTGCTACGGGTCTGAAAAGATCAGAG TCTGCAACGGCAGAAATTAAGAAGATGAGACAATCTTTGCTGCATAAAAGAGAAATGAAA AGGAAAAGAAAAACATTTTTGGTGGATGACGATCGTGTTTTGATCGGTAATAAAGTCAGT GAAGGCCATGTCAACTTTATTATAGCTTATAACATGCTAACTGGTATTCGTGTCGCAGTG TCACGTTGTTCTGGCATAATGAAACCTTTAACTCCGGCAGACTTTAGATTTACGAAGAAG CTTGCCTTTGATTATCACGGAAATGAATTGACCCCTTCTTCTCAGTATGCATTTAAGTTT AAGGACTACTGTCCCGAAGTCTTTAGGGAACTTCGTGCATTATTCGGCTTAGACCCTGCT GATTATTTGGTTTCGTTAACTTCCAAGTACATTTTGAGTGAGTTGAACTCGCCAGGTAAA AGTGGTTCATTTTTTTATTATTCGAGAGATTACAAATATATTATCAAGACCATACATCAT TCTGAGCATATTCATCTGAGAAAGCACATACAAGAATACTATAACCATGTAAGAGACAAT CCAAACACTTTGATTTGTCAATTTTATGGTTTGCATAGAGTGAAAATGCCTATATCGTTT CAAAATAAAATTAAGCATCGGAAAATTTACTTCCTAGTCATGAATAACTTATTTCCACCA CACTTAGACATTCACATTACTTATGATTTAAAAGGTTCCACATGGGGCCGTTTTACCAAT TTGGATAAAGAAAGGTTGGCGAAAGATAGATCATATAGGCCTGTGATGAAAGATTTAAAT TGGCTTGAAGAAGGTCAGAAAATTAAATTGGGTCCATTGAAGAAGAAGACTTTTTTGACA CAGCTGAAAAAAGATGTGGAATTGCTTGCTAAATTGAATACAATGGACTATTCCTTGTTA ATTGGCATTCATGACATCAATAAAGCTAAAGAAGACGACTTACAATTGGCGGATACGGCA TCTATTGAGGAGCAACCACAGACTCAAGGACCCATAAGAACCGGTACCGGAACGGTAGTA CGACATTTTTTTAGAGAGTTTGAAGGTGGAATTCGAGCATCTGATCAATTCAACAATGAT GTGGATTTGATTTATTACGTGGGGATAATCGATTTCTTGACTAATTACTCAGTTATGAAG AAATTAGAAACGTTTTGGAGAAGTCTACGCCATGATACCAAGTTGGTGAGTGCCATACCT CCAAGAGACTACGCCAATAGGTTTTACGAATTCATAGAAGATTCTGTAGATCCTCTGCCC CAGAAAAAAACTCAATCGTCGTATAGAGACGACCCTAACCAGAAAAATTATAAAGACTGA
Protein Properties
Pfam Domain Function
Protein Residues779
Protein Molecular Weight89319.60156
Protein Theoretical pI9.77
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Probable phosphatidylinositol-4-phosphate 5-kinase MSS4 MSVLRSQPPSVVPLHLTTSTSRKTEQEPSLLHSAIIERHQDRSVPNSNSNPDSNHRIKKD RNNHTSYHSSSNSESNMESPRLSDGESSTPTSIEELNPTINNSRLVKRNYSISIDPLHDN SNNNTDDDHPNTITSPRPNSTSNKEMQKYSFPEGKESKKITTPSLNSNNCLDLDNSSLVH TDSYIQDLNDDHILLNKRVSRRSSRISAVTATSTTIKQRRNTQDSNLPNIPFHASKHSQI LPMDDSDVIKLANGDTSMKPNSATKISHSMTSLPLHPLPQPSQKSKQYHMISKSTTSLPP ENDHYYQHSRGTNHNHAANAAAVNNNTTTTTAATGLKRSESATAEIKKMRQSLLHKREMK RKRKTFLVDDDRVLIGNKVSEGHVNFIIAYNMLTGIRVAVSRCSGIMKPLTPADFRFTKK LAFDYHGNELTPSSQYAFKFKDYCPEVFRELRALFGLDPADYLVSLTSKYILSELNSPGK SGSFFYYSRDYKYIIKTIHHSEHIHLRKHIQEYYNHVRDNPNTLICQFYGLHRVKMPISF QNKIKHRKIYFLVMNNLFPPHLDIHITYDLKGSTWGRFTNLDKERLAKDRSYRPVMKDLN WLEEGQKIKFGPLKKKTFLTQLKKDVELLAKLNTMDYSLLIGIHDINKAKEDDLQLADTA SIEEQPQTQGPIRTGTGTVVRHFFREFEGGIRASDQFNNDVDLIYYVGIIDFLTNYSVMK KLETFWRSLRHDTKLVSAIPPRDYANRFYEFIEDSVDPLPQKKTQSSYRDDPNQKNYKD
References
External Links
ResourceLink
Saccharomyces Genome Database MSS4
Uniprot IDP38994
Uniprot NameMSS4_YEAST
GenBank Gene IDD13716
Genebank Protein ID493719
General Reference
  • Yoshida, S., Ohya, Y., Nakano, A., Anraku, Y. (1994). "Genetic interactions among genes involved in the STT4-PKC1 pathway of Saccharomyces cerevisiae." Mol Gen Genet 242:631-640.8152413
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Desrivieres, S., Cooke, F. T., Parker, P. J., Hall, M. N. (1998). "MSS4, a phosphatidylinositol-4-phosphate 5-kinase required for organization of the actin cytoskeleton in Saccharomyces cerevisiae." J Biol Chem 273:15787-15793.9624178
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956