You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePutative mitochondrial carrier protein YHM1/SHM1
SynonymsNot Available
Gene NameYHM1
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in guanine nucleotide transmembrane transporte
Specific FunctionNot Available
Cellular LocationMitochondrion inner membrane; Multi-pass membrane protein (Potential)
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00257Guanosine diphosphateShow
YMDB00558GTPShow
YMDB00862hydronShow
GO Classification
Component
membrane
cell part
Function
binding
Process
transmembrane transport
establishment of localization
transport
Gene Properties
Chromosome LocationNot Available
LocusYDL198C
Gene Sequence>903 bp ATGCCTCATACCGATAAGAAACAATCAGGATTAGCTCGTCTTTTGGGGTCCGCCTCTGCA GGCATAATGGAAATTGCCGTCTTCCATCCTGTGGACACCATTTCCAAAAGACTGATGTCC AACCACACCAAAATAACCTCTGGCCAGGAATTGAATCGTGTTATTTTTCGTGATCATTTC AGCGAACCTTTGGGCAAACGTTTGTTTACCTTGTTCCCGGGTCTCGGTTACGCTGCATCA TACAAAGTTCTTCAAAGAGTGTATAAATATGGTGGTCAGCCTTTTGCTAACGAGTTTTTG AATAAGCACTACAAAAAGGATTTTGATAATCTTTTCGGTGAAAAGACTGGTAAGGCAATG AGATCCGCCGCTGCTGGATCTTTGATTGGTATTGGTGAAATTGTTCTTTTGCCGCTGGAC GTGTTGAAGATTAAGAGACAGACCAATCCCGAATCGTTTAAAGGTAGAGGTTTCATCAAG ATTTTGAGAGACGAAGGCCTGTTCAACTTATATAGGGGTTGGGGGTGGACGGCTGCCAGA AATGCTCCCGGTTCATTCGCCCTTTTTGGTGGTAATGCATTCGCCAAGGAGTATATCTTG GGTTTGAAAGATTATTCTCAAGCTACTTGGTCCCAAAACTTCATCTCCTCCATCGTCGGT GCTTGCTCCTCTCTGATCGTTTCTGCTCCATTAGATGTCATCAAGACAAGAATTCAAAAT AGGAATTTTGATAATCCTGAAAGCGGGTTGAGAATCGTCAAAAACACTCTGAAAAATGAA GGTGTAACTGCGTTTTTCAAGGGCTTAACACCTAAATTACTAACAACGGGTCCAAAACTG GTTTTCTCATTTGCGTTAGCTCAATCTTTGATACCTAGATTCGATAACCTGTTGAGCAAA TGA
Protein Properties
Pfam Domain Function
Protein Residues300
Protein Molecular Weight33215.19922
Protein Theoretical pI10.66
Signalling Regions
  • None
Transmembrane Regions
  • 14-34
  • 85-101
  • 122-142
  • 173-189
  • 214-234
  • 268-285
Protein Sequence>Putative mitochondrial carrier protein YHM1/SHM1 MPHTDKKQSGLARLLGSASAGIMEIAVFHPVDTISKRLMSNHTKITSGQELNRVIFRDHF SEPLGKRLFTLFPGLGYAASYKVLQRVYKYGGQPFANEFLNKHYKKDFDNLFGEKTGKAM RSAAAGSLIGIGEIVLLPLDVLKIKRQTNPESFKGRGFIKILRDEGLFNLYRGWGWTAAR NAPGSFALFGGNAFAKEYILGLKDYSQATWSQNFISSIVGACSSLIVSAPLDVIKTRIQN RNFDNPESGLRIVKNTLKNEGVTAFFKGLTPKLLTTGPKLVFSFALAQSLIPRFDNLLSK
References
External Links
ResourceLink
Saccharomyces Genome Database YHM1
Uniprot IDP38988
Uniprot NameYHM1_YEAST
GenBank Gene IDAY693086
Genebank Protein ID51013623
General Reference
  • Kao, L. R., Megraw, T. L., Chae, C. B. (1996). "SHM1: a multicopy suppressor of a temperature-sensitive null mutation in the HMG1-like abf2 gene." Yeast 12:1239-1250.8905928
  • Verhasselt, P., Voet, M., Mathys, J., Volckaert, G. (1996). "The sequence of 23 kb surrounding the SNF3 locus on the left arm of yeast chromosome IV reveals the location of five known genes and characterizes at least six new open reading frames including putative genes for ribosomal protein L35 and a sugar transport protein." Yeast 12:1065-1070.8896272
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287