You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePhosphoribosylformylglycinamidine synthase
Synonyms
  • FGAM synthase
  • FGAMS
  • Formylglycinamide ribotide amidotransferase
  • FGARAT
  • Formylglycinamide ribotide synthetase
Gene NameADE6
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionATP + N(2)-formyl-N(1)-(5-phospho-D- ribosyl)glycinamide + L-glutamine + H(2)O = ADP + phosphate + 2- (formamido)-N(1)-(5-phospho-D-ribosyl)acetamidine + L-glutamate
Cellular LocationCytoplasm
SMPDB PathwaysNot Available
KEGG Pathways
Purine metabolismec00230 Map00230
SMPDB ReactionsNot Available
KEGG Reactions
Adenosine triphosphate + water + L-Glutamine + 5'-Phosphoribosyl-N-formylglycinamidephosphate + L-Glutamic acid + hydron + 2-(Formamido)-N1-(5-phospho-D-ribosyl)acetamidine + ADP
Metabolites
YMDB IDNameView
YMDB000015'-Phosphoribosyl-N-formylglycinamideShow
YMDB00002L-GlutamineShow
YMDB00109Adenosine triphosphateShow
YMDB00271L-Glutamic acidShow
YMDB003982-(Formamido)-N1-(5-phospho-D-ribosyl)acetamidineShow
YMDB007582-formamido-N(1)-(5-phospho-D-ribosyl)acetamidineShow
YMDB00759N(2)-formyl-N(1)-(5-phospho-D-ribosyl)glycinamideShow
YMDB00862hydronShow
YMDB00890waterShow
YMDB00907phosphateShow
YMDB00914ADPShow
GO Classification
Component
Not Available
Function
catalytic activity
ligase activity
ligase activity, forming carbon-nitrogen bonds
carbon-nitrogen ligase activity, with glutamine as amido-N-donor
phosphoribosylformylglycinamidine synthase activity
Process
IMP biosynthetic process
metabolic process
'de novo' IMP biosynthetic process
nitrogen compound metabolic process
cellular nitrogen compound metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
nucleobase, nucleoside and nucleotide metabolic process
nucleoside phosphate metabolic process
nucleotide metabolic process
purine nucleotide metabolic process
purine nucleotide biosynthetic process
purine nucleoside monophosphate biosynthetic process
purine ribonucleoside monophosphate biosynthetic process
Gene Properties
Chromosome Locationchromosome 7
LocusYGR061C
Gene Sequence>4077 bp ATGACTGATTATATTTTGCCGGGTCCCAAGGCCTTATCTCAGTTCAGAGTCGATAATCTA ATTAAAGATATAAACTCCTATACAAACAGTACTTCTGTCATCAATGAATTGCGTTCGTGT TACATTCACTATGTCAACGGCATCGCTCAAAATTTGTCTGAACAGGACACTAAATTGCTA GAAGTTTTGTTGACTTACGATTCTGCTTTAGATATTGCTAACGATCCATTAGCAAGACAA TTAAACGATGCTGTCGCTAATAATTTACCCAGTTCAGCTCTTGGCGAAGACACATATTTG ATTAGAGTTGTTCCTAGATCAGGCACTATCTCTCCTTGGTCTTCCAAGGCTACTAATATT GCTCATGTATGCGGGCTACAAGACAAAGTTCAACGTATTGAAAGAGGTTTAGCCTTACTC ATAAAGACTGTTCCAGGTTTCCCTCTTTTGGAAAATCTAAATGATATTTCATTGAAGTGT GTCTACGATAGGATGACACAACAATTATATCTGACCGAACCACCAAATACGATGAGTATT TTCACACATGAAGAGCCAAAGCCATTAGTTCACGTTCCTTTAACTCCTAAGGACACTAAA CAGTCTCCAAAGGATATTTTATCCAAAGCTAATACGGAATTGGGTTTAGCTCTAGATAGT GGAGAAATGGAATATTTGATTCATGCATTCGTCGAAACTATGAAAAGAGATCCTACTGAT GTTGAGTTATTTATGTTCGCTCAAGTTAATTCTGAACATTGTCGTCACAAGATCTTCAAT GCTGATTGGACCATTGATGGAATAAAACAACAATTCACCTTGTTTCAAATGATTAGAAAT ACCCATAAATTAAACCCAGAATATACTATTAGCGCCTATTCTGATAATGCAGCCGTTTTG GATAGTGAAAATGATGCCTTTTTCTTTGCACCAAATTCAACTACAAAGGAATGGACCTCT ACAAAGGAAAGAATTCCATTACTTATCAAAGTCGAAACTCACAACCATCCAACAGCCGTG TCTCCTTTCCCAGGTGCTGCTACAGGTTCTGGTGGTGAAATCAGAGACGAGGGTGCTACA GGCAGAGGTTCCAAGACTAAGTGTGGTTTGAGTGGATTCTCTGTCAGCGACCTTTTGATA CCAGGTAATGAACAACCTTGGGAGTTGAATATTGGTAAGCCTTACCATATTGCATCTGCA TTAGATATTATGATTGAGGCTCCTTTGGGTTCAGCTGCATTTAACAATGAGTTTGGTAGA CCTTGTATAAACGGTTACTTCAGAACTTTAACTACAAAGGTTTTGAATCACCAAGGGAAG GAGGAAATCAGAGGGTTCCACAAGCCAATTATGATTGCGGGTGGTTTCGGTACTGTTAGA CCTCAATTTGCTTTGAAGAACACCCCAATAACTCCAGGCTCTTGTTTAATTGTACTTGGT GGTCAATCTATGCTGATTGGTTTAGGTGGTGGTGCTGCTTCTTCTGTAGCTTCCGGTGAA GGTTCCGCCGATTTGGATTTTGCTTCTGTACAAAGAGGGAACCCCGAAATGGAACGTCGT TGCCAACAAGTGATTGACGCTTGTGTTGCCTTAGGTAACAATAATCCTATCCAATCTATT CACGATGTTGGTGCTGGTGGGTTATCCAACGCTTTGCCAGAATTGGTTCATGACAATGAC TTGGGTGCTAAATTCGATATTAGAAAGGTCCTCTCCTTAGAACCTGGTATGTCACCAATG GAAATTTGGTGTAATGAATCACAAGAACGTTATGTTCTTGGTGTTTCTCCTCAAGACTTA TCCATTTTCGAGGAAATCTGTAAGAGAGAAAGAGCACCATTTGCTGTCGTCGGTCACGCA ACCGCTGAACAAAAATTGATTGTAGAAGATCCTCTTTTGAAAACAACTCCAATTGATTTA GAAATGCCAATTTTATTTGGTAAGCCTCCAAAGATGTCAAGAGAAACCATAACTGAAGCA CTAAATCTACCAGAGGCAAATTTGAGCGAAATTCCTTCCCTACAAGATGCTATTCAAAGA GTTCTAAACTTACCATCTGTTGGCTCAAAGTCATTTTTGATTACTATTGGTGACAGATCC GTCACAGGTCTAATTGATAGGGATCAATTTGTTGGTCCTTGGCAAGTACCTGTTGCGGAT GTCGGTGTTACCGGTACCTCTTTGGGTGAGACAATAATTTCCACAGGTGAAGCCATGGCT ATGGGTGAAAAACCAGTTAACGCCCTAATCTCCGCATCTGCTTCCGCTAAATTATCTGTG GCAGAATCTTTATTGAACATATTCGCTGCTGATGTGAAATCTTTAAATCATATCAAGCTA TCTGCTAACTGGATGTCTCCAGCCTCTCATCAAGGTGAGGGTTCTAAGTTATATGAAGCC GTTCAAGCATTAGGTCTGGATTTATGTCCTGCATTAGGTGTTGCTATCCCTGTTGGTAAG GATTCCATGTCCATGAAGATGAAATGGGATGATAAGGAAGTTACTGCACCATTGTCATTG AATATCACAGCATTTGCACCAGTTTTCAACACTAGTAAAACGTGGACTCCATTGCTAAAT AGAAACACAGATGATTCTGTCCTTGTCTTGGTTGATCTATCAGCTAAACAAGAGACTAAG TCACTAGGTGCCTCTGCTTTGTTGCAAGTTTACAACCAAGTTGGTAACAAGTCGCCTACT GTGTATGATAACGCCATTTTGAAGGGTTTCTTGGAAAGTTTAATCCAATTGCATCAACAA AAGGAGGATATAGTGCTTGCCTACCATGATAGGTCTGATGGTGGTCTACTAATCACTTTA CTGGAAATGGCATTTGCTTCCAGATGCGGCTTAGAAATCAACATTGACGGTGGAGACCTA GAAAGTCAATTAACAAACCTATTCAATGAAGAATTAGGTGCAGTATTCCAGATTTCTGCT AAGAACTTGAGCAAGTTCGAAAAAATCTTGAACGAGAACGGAGTTGCTAAAGAATATATT TCTATTGTTGGTAAGCCATCCTTCCAAAGCCAGGAAATCAAGATTATTAACTCCACAACA AATGATGTAATTTACGCCAATTCGAGATCTGAATTGGAGCAAACTTGGAGTAAGACATCT TACGAAATGCAGAAATTGAGAGACAATCCAAAAACAGCCGAAGAAGAGTTTGCCAGTATC ACGGACGATAGAGATCCCGGTTTGCAGTATGCCCTAACATACAACCCAGCCGATGATATG AAGATCGGATTAGAATTATCCAGTCAAAGGCCAAAGGTTGCTATCTTAAGAGAGCAAGGT GTGAACGGTCAAATGGAAATGGCATGGTGCTTCCAACAAGCTGGATTCAACTCAGTGGAT GTCACTATGACAGATTTGCTAGAAGGTAGGTTCCATTTGGATGACTTCATCGGTCTTGCC GCATGTGGTGGTTTCTCTTATGGTGATGTCTTAGGTGCAGGTGCGGGTTGGGCTAAATCC GTATTGTATCACGAAGGTGTGCGCTCGCAATTTTCTAAGTTCTTCAATGAAAGACAAGAT ACATTTGCTTTTGGTGCTTGTAATGGTTGTCAATTCTTGAGTAGATTAAAAGATATCATA CCCGGGTGTGAAAACTGGCCAAGTTTCGAAAGAAATGTTAGTGAACAATATGAAGCCCGT GTATGTATGGTGCAAATATCTCAAGAAAAGGACAATTCTAGCGAGGAATCTGTTTTCTTG AATGGCATGGCAGGATCCAAATTGCCAATTGCTGTCGCACATGGTGAAGGTAAAGCAACA TTTTCTAAAAGCGCTGAACAACTGGAAAAGTTCGAAAAGGATGGTTTATGTTGTATAAGG TATGTGGACAACTACGGTAACGTCACCGAAAGGTTCCCCTTCAACCCCAATGGGTCGACC AATGGTATTGCCGGTATCAAGTCACCAAATGGTAGAGTGCTTGCCATGATGCCACATCCT GAAAGAGTTTGCAGATTGGAGGCCAATTCCTGGTATCCAGAGGGCAAATACGAAGAGTGG GGTGGATACGGTCCATGGATTAGATTATTCAGATCTGCCAGAAGATGGGTCGGTTGA
Protein Properties
Pfam Domain Function
Protein Residues1358
Protein Molecular Weight148904.0
Protein Theoretical pI4.92
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Phosphoribosylformylglycinamidine synthase MTDYILPGPKALSQFRVDNLIKDINSYTNSTSVINELRSCYIHYVNGIAQNLSEQDTKLL EVLLTYDSALDIANDPLARQLNDAVANNLPSSALGEDTYLIRVVPRSGTISPWSSKATNI AHVCGLQDKVQRIERGLALLIKTVPGFPLLENLNDISLKCVYDRMTQQLYLTEPPNTMSI FTHEEPKPLVHVPLTPKDTKQSPKDILSKANTELGLALDSGEMEYLIHAFVETMKRDPTD VELFMFAQVNSEHCRHKIFNADWTIDGIKQQFTLFQMIRNTHKLNPEYTISAYSDNAAVL DSENDAFFFAPNSTTKEWTSTKERIPLLIKVETHNHPTAVSPFPGAATGSGGEIRDEGAT GRGSKTKCGLSGFSVSDLLIPGNEQPWELNIGKPYHIASALDIMIEAPLGSAAFNNEFGR PCINGYFRTLTTKVLNHQGKEEIRGFHKPIMIAGGFGTVRPQFALKNTPITPGSCLIVLG GQSMLIGLGGGAASSVASGEGSADLDFASVQRGNPEMERRCQQVIDACVALGNNNPIQSI HDVGAGGLSNALPELVHDNDLGAKFDIRKVLSLEPGMSPMEIWCNESQERYVLGVSPQDL SIFEEICKRERAPFAVVGHATAEQKLIVEDPLLKTTPIDLEMPILFGKPPKMSRETITEA LNLPEANLSEIPSLQDAIQRVLNLPSVGSKSFLITIGDRSVTGLIDRDQFVGPWQVPVAD VGVTGTSLGETIISTGEAMAMGEKPVNALISASASAKLSVAESLLNIFAADVKSLNHIKL SANWMSPASHQGEGSKLYEAVQALGLDLCPALGVAIPVGKDSMSMKMKWDDKEVTAPLSL NITAFAPVFNTSKTWTPLLNRNTDDSVLVLVDLSAKQETKSLGASALLQVYNQVGNKSPT VYDNAILKGFLESLIQLHQQKEDIVLAYHDRSDGGLLITLLEMAFASRCGLEINIDGGDL ESQLTNLFNEELGAVFQISAKNLSKFEKILNENGVAKEYISIVGKPSFQSQEIKIINSTT NDVIYANSRSELEQTWSKTSYEMQKLRDNPKTAEEEFASITDDRDPGLQYALTYNPADDM KIGLELSSQRPKVAILREQGVNGQMEMAWCFQQAGFNSVDVTMTDLLEGRFHLDDFIGLA ACGGFSYGDVLGAGAGWAKSVLYHEGVRSQFSKFFNERQDTFAFGACNGCQFLSRLKDII PGCENWPSFERNVSEQYEARVCMVQISQEKDNSSEESVFLNGMAGSKLPIAVAHGEGKAT FSKSAEQLEKFEKDGLCCIRYVDNYGNVTERFPFNPNGSTNGIAGIKSPNGRVLAMMPHP ERVCRLEANSWYPEGKYEEWGGYGPWIRLFRSARRWVG
References
External Links
ResourceLink
Saccharomyces Genome Database ADE6
Uniprot IDP38972
Uniprot NamePUR4_YEAST
GenBank Gene IDZ72846
Genebank Protein ID1323079
General Reference
  • Tettelin, H., Agostoni Carbone, M. L., Albermann, K., Albers, M., Arroyo, J., Backes, U., Barreiros, T., Bertani, I., Bjourson, A. J., Bruckner, M., Bruschi, C. V., Carignani, G., Castagnoli, L., Cerdan, E., Clemente, M. L., Coblenz, A., Coglievina, M., Coissac, E., Defoor, E., Del Bino, S., Delius, H., Delneri, D., de Wergifosse, P., Dujon, B., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII." Nature 387:81-84.9169869
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956