You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameBasic amino-acid permease
SynonymsNot Available
Gene NameALP1
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in transport
Specific FunctionHigh-affinity permease for basic amino acids
Cellular LocationMembrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00592L-ArginineShow
YMDB00862hydronShow
GO Classification
Component
cell part
membrane
membrane part
intrinsic to membrane
integral to membrane
Function
amino acid transmembrane transporter activity
transporter activity
transmembrane transporter activity
active transmembrane transporter activity
amine transmembrane transporter activity
Process
amine transport
amino acid transport
transmembrane transport
establishment of localization
transport
Gene Properties
Chromosome Locationchromosome 14
LocusYNL270C
Gene Sequence>1722 bp ATGGATGAAACTGTGAACATACAAATGTCCAAGGAAGGTCAGTATGAAATCAATTCTAGC TCTATAATAAAAGAGGAGGAGTTTGTAGATGAACAATATTCTGGGGAGAACGTTACGAAG GCCATCACCACAGAGAGAAAAGTCGAGGATGATGCTGCTAAGGAAACAGAGAGCTCACCA CAAGAAAGAAGAGAGGTGAAGCGGAAGTTAAAGCAGCGGCATATAGGGATGATTGCTCTC GGCGGCACCATTGGGACGGGCCTCATAATTGGTATTGGTCCGCCATTGGCACACGCCGGC CCTGTTGGTGCCTTGATATCGTATTTATTTATGGGGACAGTGATTTACTCCGTTACACAA TCGTTAGGAGAGATGGTCACTTTTATCCCGGTTACATCTTCATTTTCTGTCTTCGCCCAA AGATTTCTGTCGCCAGCGCTGGGAGCGACTAACGGATATATGTACTGGCTGTCGTGGTGT TTCACCTTCGCACTGGAACTATCCGTTTTGGGGAAAGTTATTCAGTACTGGACAGAAGCA GTGCCTCTAGCGGCTTGGATCGTGATCTTTTGGTGCCTGTTAACTTCAATGAACATGTTT CCCGTAAAGTATTACGGAGAATTTGAGTTTTGTATTGCCTCCATAAAGGTCATCGCGTTG CTCGGTTTTATCATTTTCTCATTCTGTGTTGTGTGTGGTGCGGGACAATCTGATGGACCC ATCGGTTTCAGGTACTGGAGAAATCCAGGAGCCTGGGGGCCTGGCATTATCTCCAGTGAT AAAAATGAGGGCCGTTTTCTCGGATGGGTTTCCTCTTTGATTAATGCTGCATTTACGTAC CAAGGTACTGAACTGGTTGGGATAACCGCTGGTGAAGCGGCTAACCCAAGAAAAGCTCTC CCGAGGGCAATAAAGAAAGTTGTAGTGAGGATTCTAGTCTTTTACATTCTTTCACTATTT TTCATTGGCCTTTTGGTCCCATATAATGACCCAAAGTTGGATAGTGACGGTATATTTGTC TCTTCATCGCCCTTTATGATAAGCATTGAGAATTCAGGCACAAAAGTTCTCCCAGATATA TTTAACGCGGTCGTGCTAATCACCATTCTTTCCGCAGGTAACTCTAATGTGTACATTGGC TCAAGAGTACTGTATAGTCTGTCTAAAAATAGCTTGGCGCCAAGGTTCTTGTCTAACGTG ACCAGAGGTGGTGTTCCATACTTTTCTGTTCTATCTACATCCGTGTTCGGATTTTTGGCT TTCTTAGAGGTTTCTGCAGGCAGCGGCAAGGCCTTTAACTGGTTATTGAACATAACTGGT GTGGCCGGTTTCTTTGCCTGGCTTTTGATTTCATTTTCTCATATCCGTTTCATGCAAGCC ATAAGGAAACGTGGTATATCGAGGGATGACTTACCTTATAAAGCTCAAATGATGCCTTTT TTGGCATATTATGCATCTTTTTTCATCGCTCTAATTGTTCTGATCCAGGGCTTCACCGCT TTCGCACCTACTTTTCAGCCTATAGACTTTGTCGCTGCATATATATCAATATTCCTATTT TTGGCCATATGGTTATCATTCCAAGTTTGGTTTAAGTGCCGCTTACTCTGGAAGCTGCAG GATATCGATATCGATTCTGACCGCCGGCAAATAGAGGAGTTGGTATGGATAGAGCCAGAA TGTAAAACAAGGTGGCAACGAGTTTGGGATGTCCTTTCATAA
Protein Properties
Pfam Domain Function
Protein Residues573
Protein Molecular Weight64012.89844
Protein Theoretical pI8.0
Signalling Regions
  • None
Transmembrane Regions
  • 74-93
  • 96-116
  • 154-174
  • 180-200
  • 210-230
  • 266-286
  • 307-327
  • 360-380
  • 404-424
  • 432-452
  • 478-498
  • 511-531
Protein Sequence>Basic amino-acid permease MDETVNIQMSKEGQYEINSSSIIKEEEFVDEQYSGENVTKAITTERKVEDDAAKETESSP QERREVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVTQ SLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYWTEA VPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGP IGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAL PRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFMISIENSGTKVLPDI FNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLA FLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPF LAYYASFFIALIVLIQGFTAFAPTFQPIDFVAAYISIFLFLAIWLSFQVWFKCRLLWKLQ DIDIDSDRRQIEELVWIEPECKTRWQRVWDVLS
References
External Links
ResourceLink
Saccharomyces Genome Database ALP1
Uniprot IDP38971
Uniprot NameALP1_YEAST
GenBank Gene IDX92494
Genebank Protein ID1045240
General Reference
  • Sychrova, H., Chevallier, M. R. (1994). "APL1, a yeast gene encoding a putative permease for basic amino acids." Yeast 10:653-657.7941748
  • Sen-Gupta, M., Lyck, R., Fleig, U., Niedenthal, R. K., Hegemann, J. H. (1996). "The sequence of a 24,152 bp segment from the left arm of chromosome XIV from Saccharomyces cerevisiae between the BNI1 and the POL2 genes." Yeast 12:505-514.8740425
  • Philippsen, P., Kleine, K., Pohlmann, R., Dusterhoft, A., Hamberg, K., Hegemann, J. H., Obermaier, B., Urrestarazu, L. A., Aert, R., Albermann, K., Altmann, R., Andre, B., Baladron, V., Ballesta, J. P., Becam, A. M., Beinhauer, J., Boskovic, J., Buitrago, M. J., Bussereau, F., Coster, F., Crouzet, M., D'Angelo, M., Dal Pero, F., De Antoni, A., Del Rey, F., Doignon, F., Domdey, H., Dubois, E., Fiedler, T., Fleig, U., Floeth, M., Fritz, C., Gaillardin, C., Garcia-Cantalejo, J. M., Glansdorff, N. N., Goffeau, A., Gueldener, U., Herbert, C., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hinni, K., Iraqui Houssaini, I., Jacquet, M., Jimenez, A., Jonniaux, J. L., Karpfinger, L., Lanfranchi, G., Lepingle, A., Levesque, H., Lyck, R., Maftahi, M., Mallet, L., Maurer, K. C., Messenguy, F., Mewes, H. W., Mosti, D., Nasr, F., Nicaud, J. M., Niedenthal, R. K., Pandolfo, D., Pierard, A., Piravandi, E., Planta, R. J., Pohl, T. M., Purnelle, B., Rebischung, C., Remacha, M., Revuelta, J. L., Rinke, M., Saiz, J. E., Sartorello, F., Scherens, B., Sen-Gupta, M., Soler-Mira, A., Urbanus, J. H., Valle, G., Van Dyck, L., Verhasselt, P., Vierendeels, F., Vissers, S., Voet, M., Volckaert, G., Wach, A., Wambutt, R., Wedler, H., Zollner, A., Hani, J. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIV and its evolutionary implications." Nature 387:93-98.9169873
  • Regenberg, B., During-Olsen, L., Kielland-Brandt, M. C., Holmberg, S. (1999). "Substrate specificity and gene expression of the amino-acid permeases in Saccharomyces cerevisiae." Curr Genet 36:317-328.10654085
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258