You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameCalcium-transporting ATPase 2
Synonyms
  • Vacuolar Ca(2+)-ATPase
Gene NamePMC1
Enzyme Class
Biological Properties
General FunctionInvolved in nucleotide binding
Specific FunctionThis magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of calcium. Transports the calcium to the vacuole and participates in the control of the cytosolic free calcium
Cellular LocationVacuole membrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00109Adenosine triphosphateShow
YMDB00358Calcium(2+)Show
YMDB00890waterShow
YMDB00907phosphateShow
YMDB00914ADPShow
GO Classification
Component
cell part
membrane
Function
ATP binding
transporter activity
cation transmembrane transporter activity
transmembrane transporter activity
inorganic cation transmembrane transporter activity
di-, tri-valent inorganic cation transmembrane transporter activity
calcium ion transmembrane transporter activity
hydrolase activity
calcium-transporting ATPase activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
ATPase activity, coupled to transmembrane movement of ions
ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism
hydrolase activity, acting on acid anhydrides
binding
hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
catalytic activity
adenyl ribonucleotide binding
Process
ATP biosynthetic process
metabolic process
establishment of localization
nitrogen compound metabolic process
transport
cellular nitrogen compound metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
di-, tri-valent inorganic cation transport
nucleobase, nucleoside and nucleotide metabolic process
divalent metal ion transport
nucleoside phosphate metabolic process
ion transport
calcium ion transport
nucleotide metabolic process
purine nucleotide metabolic process
purine nucleotide biosynthetic process
cation transport
purine nucleoside triphosphate biosynthetic process
purine ribonucleoside triphosphate biosynthetic process
Gene Properties
Chromosome Locationchromosome 7
LocusYGL006W
Gene Sequence>3522 bp ATGTCTAGACAAGACGAAAATTCTGCTTTACTAGCGAATAATGAAAATAACAAACCATCG TATACGGGAAATGAGAACGGAGTCTACGATAATTTCAAATTATCAAAAAGTCAACTTTCG GATCTTCATAACCCTAAATCAATAAGATCATTTGTCAGATTATTTGGATATGAGTCTAAC AGCCTCTTCAAATACTTGAAAACAGATAAAAATGCAGGCATTTCTCTTCCAGAAATATCA AATTATCGAAAGACAAACCGGTATAAAAATTATGGCGATAATTCACTTCCTGAAAGAATA CCAAAGTCTTTTTTACAATTAGTATGGGCTGCTTTTAATGACAAAACAATGCAATTACTG ACAGTCGCCGCTGTTGTTTCCTTTGTTTTAGGTCTATACGAACTATGGATGCAACCTCCA CAGTATGATCCTGAAGGAAATAAAATTAAGCAAGTTGACTGGATTGAAGGGGTTGCTATC ATGATTGCGGTCTTTGTGGTAGTTCTAGTGAGTGCCGCTAACGATTACCAGAAGGAGTTG CAATTTGCAAAGCTAAATAAAAAGAAGGAAAACCGTAAAATTATAGTCATAAGAAATGAT CAGGAAATATTAATTTCCATTCACCACGTTTTAGTCGGTGATGTCATTTCATTACAAACC GGTGATGTTGTCCCCGCTGATTGTGTTATGATATCAGGGAAGTGTGAGGCAGATGAATCA TCCATCACTGGTGAATCTAACACAATACAGAAATTTCCGGTGGATAACTCATTAAGAGAT TTCAAAAAATTTAATTCTATCGATAGTCATAACCATAGCAAACCATTAGATATAGGTGAC GTTAACGAAGACGGTAACAAGATTGCTGATTGTATGTTGATTTCAGGTTCCAGAATTCTC TCTGGCTTGGGCAGGGGTGTCATCACGTCCGTGGGTATAAACTCAGTTTACGGTCAAACC ATGACTTCATTAAATGCCGAACCTGAAAGTACTCCATTACAGTTACATTTGAGCCAATTG GCTGATAATATATCCGTTTACGGTTGCGTGTCTGCTATAATTCTTTTCTTGGTCCTTTTC ACTAGGTACTTATTTTACATAATACCTGAGGATGGCAGGTTCCATGATCTAGATCCCGCT CAAAAGGGTTCTAAATTTATGAACATTTTTATCACATCTATCACGGTTATTGTGGTGGCT GTTCCGGAAGGTTTACCATTAGCTGTAACTTTGGCCTTAGCGTTTGCAACAACAAGAATG ACAAAAGACGGTAATTTAGTACGGGTTTTAAGAAGCTGTGAAACGATGGGATCTGCTACT GCAGTGTGCTCTGATAAGACTGGCACTTTGACAGAAAATGTCATGACTGTCGTTCGTGGC TTCCCGGGCAATTCTAAATTTGATGATAGTAAATCGTTGCCCGTTAGCGAACAAAGGAAG CTGAATTCTAAGAAAGTTTTTGAAGAAAATTGTTCGTCATCCTTGAGAAATGATTTATTA GCCAATATTGTCCTGAATTCTACCGCCTTCGAAAACAGAGATTATAAGAAAAACGATAAA AATACAAATGGTAGTAAAAATATGTCAAAAAATTTGAGTTTTTTAGATAAGTGTAAATCT AGATTATCGTTTTTTAAAAAAGGCAACAGGGAAGATGACGAGGATCAATTATTCAAAAAT GTCAACAAGGGTAGGCAAGAACCCTTTATTGGCTCTAAAACGGAAACAGCCTTACTCAGT TTGGCAAGATTATCATTAGGATTACAACCGGGAGAATTGCAATATTTGAGAGATCAACCG ATGGAAAAGTTTAATATCGAAAAAGTTGTTCAAACAATTCCGTTTGAAAGTTCTCGTAAA TGGGCCGGCTTAGTGGTAAAGTACAAAGAAGGCAAAAATAAAAAACCATTTTACAGGTTT TTCATTAAAGGTGCAGCAGAAATTGTTTCCAAGAATTGTTCGTACAAGAGGAATTCAGAT GATACTTTGGAAGAAATCAATGAGGACAATAAAAAAGAAACTGATGATGAAATCAAAAAT CTTGCGTCCGATGCTCTCAGAGCCATAAGTGTTGCCCACAAAGATTTCTGCGAATGTGAT AGCTGGCCCCCTGAACAGCTGCGTGATAAAGACTCACCAAATATAGCTGCTCTTGACTTG CTATTTAACAGTCAAAAGGGCTTAATTCTAGATGGTTTACTTGGGATTCAAGACCCTTTA CGTGCAGGCGTTAGGGAGTCAGTACAACAGTGCCAACGTGCTGGTGTAACTGTGCGTATG GTTACTGGTGACAATATATTAACAGCAAAAGCAATCGCGAGGAATTGTGCGATTCTTTCT ACTGATATTAGTTCAGAGGCTTATTCTGCAATGGAAGGCACTGAATTCAGAAAGTTAACG AAAAACGAACGTATAAGAATCCTGCCAAATTTAAGGGTCTTAGCAAGGTCTTCGCCTGAG GATAAAAGGTTATTAGTAGAAACATTGAAGGGGATGGGAGATGTTGTTGCGGTCACTGGC GATGGTACGAACGATGCTCCAGCTTTAAAGCTAGCTGATGTTGGTTTCTCAATGGGTATT TCCGGTACGGAGGTTGCCAGAGAGGCTTCTGACATTATTTTGATGACTGATGATTTCTCA GCTATTGTCAACGCTATTAAGTGGGGAAGATGTGTTTCAGTCTCCATAAAAAAGTTCATA CAGTTTCAATTAATTGTTAATATCACCGCAGTGATTTTAACGTTCGTTTCATCCGTTGCA TCTAGTGATGAAACATCAGTACTGACGGCGGTCCAACTGTTATGGATCAATCTAATCATG GATACTCTAGCAGCTTTAGCTTTAGCCACTGATAAACCCGATCCAAATATCATGGACAGA AAACCTAGGGGCCGCTCAACTTCTTTGATTTCTGTGTCAACTTGGAAAATGATTCTATCA CAAGCTACATTGCAGTTGATAGTTACTTTCATTTTGCATTTTTACGGGCCAGAGTTATTC TTCAAGAAACATGAAGATGAAATAACAAGTCACCAACAGCAGCAACTGAATGCCATGACA TTCAACACTTTTGTTTGGTTGCAATTTTTTACCATGTTAGTATCGAGAAAATTAGATGAA GGTGATGGTATATCAAACTGGAGAGGCAGGATTTCTGCCGCCAATTTGAATTTCTTCCAA GACTTGGGTAGAAACTATTATTTTCTCACGATCATGGCGATCATTGGCAGCTGTCAAGTT TTAATCATGTTTTTTGGTGGCGCACCATTTTCTATTGCCAGACAAACCAAATCAATGTGG ATAACCGCGGTACTGTGTGGTATGTTGTCTCTAATCATGGGGGTGCTAGTGAGAATCTGC CCCGATGAAGTAGCAGTGAAGGTATTTCCGGCTGCTTTCGTTCAAAGATTCAAGTACGTA TTTGGACTCGAGTTCCTCAGAAAAAACCATACTGGAAAACACGACGATGAAGAAGCGCTG TTGGAGGAATCTGATAGTCCAGAGTCCACCGCCTTTTATTAA
Protein Properties
Pfam Domain Function
Protein Residues1173
Protein Molecular Weight130860.0
Protein Theoretical pI7.42
Signalling Regions
  • None
Transmembrane Regions
  • 115-139
  • 153-173
  • 350-368
  • 389-409
  • 900-922
  • 930-950
  • 977-998
  • 1011-1029
  • 1066-1086
  • 1100-1120
Protein Sequence>Calcium-transporting ATPase 2 MSRQDENSALLANNENNKPSYTGNENGVYDNFKLSKSQLSDLHNPKSIRSFVRLFGYESN SLFKYLKTDKNAGISLPEISNYRKTNRYKNYGDNSLPERIPKSFLQLVWAAFNDKTMQLL TVAAVVSFVLGLYELWMQPPQYDPEGNKIKQVDWIEGVAIMIAVFVVVLVSAANDYQKEL QFAKLNKKKENRKIIVIRNDQEILISIHHVLVGDVISLQTGDVVPADCVMISGKCEADES SITGESNTIQKFPVDNSLRDFKKFNSIDSHNHSKPLDIGDVNEDGNKIADCMLISGSRIL SGLGRGVITSVGINSVYGQTMTSLNAEPESTPLQLHLSQLADNISVYGCVSAIILFLVLF TRYLFYIIPEDGRFHDLDPAQKGSKFMNIFITSITVIVVAVPEGLPLAVTLALAFATTRM TKDGNLVRVLRSCETMGSATAVCSDKTGTLTENVMTVVRGFPGNSKFDDSKSLPVSEQRK LNSKKVFEENCSSSLRNDLLANIVLNSTAFENRDYKKNDKNTNGSKNMSKNLSFLDKCKS RLSFFKKGNREDDEDQLFKNVNKGRQEPFIGSKTETALLSLARLSLGLQPGELQYLRDQP MEKFNIEKVVQTIPFESSRKWAGLVVKYKEGKNKKPFYRFFIKGAAEIVSKNCSYKRNSD DTLEEINEDNKKETDDEIKNLASDALRAISVAHKDFCECDSWPPEQLRDKDSPNIAALDL LFNSQKGLILDGLLGIQDPLRAGVRESVQQCQRAGVTVRMVTGDNILTAKAIARNCAILS TDISSEAYSAMEGTEFRKLTKNERIRILPNLRVLARSSPEDKRLLVETLKGMGDVVAVTG DGTNDAPALKLADVGFSMGISGTEVAREASDIILMTDDFSAIVNAIKWGRCVSVSIKKFI QFQLIVNITAVILTFVSSVASSDETSVLTAVQLLWINLIMDTLAALALATDKPDPNIMDR KPRGRSTSLISVSTWKMILSQATLQLIVTFILHFYGPELFFKKHEDEITSHQQQQLNAMT FNTFVWLQFFTMLVSRKLDEGDGISNWRGRISAANLNFFQDLGRNYYFLTIMAIIGSCQV LIMFFGGAPFSIARQTKSMWITAVLCGMLSLIMGVLVRICPDEVAVKVFPAAFVQRFKYV FGLEFLRKNHTGKHDDEEALLEESDSPESTAFY
References
External Links
ResourceLink
Saccharomyces Genome Database PMC1
Uniprot IDP38929
Uniprot NameATC2_YEAST
GenBank Gene IDU03060
Genebank Protein ID454003
General Reference
  • Cunningham, K. W., Fink, G. R. (1994). "Calcineurin-dependent growth control in Saccharomyces cerevisiae mutants lacking PMC1, a homolog of plasma membrane Ca2+ ATPases." J Cell Biol 124:351-363.7507493
  • Tettelin, H., Agostoni Carbone, M. L., Albermann, K., Albers, M., Arroyo, J., Backes, U., Barreiros, T., Bertani, I., Bjourson, A. J., Bruckner, M., Bruschi, C. V., Carignani, G., Castagnoli, L., Cerdan, E., Clemente, M. L., Coblenz, A., Coglievina, M., Coissac, E., Defoor, E., Del Bino, S., Delius, H., Delneri, D., de Wergifosse, P., Dujon, B., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII." Nature 387:81-84.9169869
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106