You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePutative mitochondrial carrier protein PET8
SynonymsNot Available
Gene NamePET8
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in binding
Specific FunctionNot Available
Cellular LocationMitochondrion inner membrane; Multi-pass membrane protein (Potential)
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00438S-Adenosyl-L-methionineShow
GO Classification
Component
cell part
membrane
Function
binding
Process
establishment of localization
transport
transmembrane transport
Gene Properties
Chromosome Locationchromosome 14
LocusYNL003C
Gene Sequence>855 bp ATGAATACTTTTTTTCTTTCCTTGCTAAGTGGCGCCGCTGCTGGTACCTCTACGGATTTG GTTTTTTTCCCTATAGACACAATTAAAACCAGGCTTCAAGCTAAGGGTGGATTCTTTGCT AATGGAGGATACAAAGGCATATATCGTGGTTTGGGAAGCGCTGTTGTAGCATCGGCGCCA GGTGCTTCACTTTTCTTTATTAGTTATGATTATATGAAAGTAAAATCAAGGCCATATATC AGCAAACTTTACTCACAGGGATCTGAGCAATTGATTGATACGACAACGCACATGCTTTCC TCTTCCATTGGTGAAATTTGTGCTTGTCTTGTTCGAGTTCCCGCAGAAGTCGTTAAGCAA AGGACGCAAGTTCACTCTACCAATTCTTCCTGGCAGACTTTACAGTCAATTCTACGAAAT GACAATAAGGAAGGTTTAAGGAAAAATCTTTATAGAGGGTGGTCTACCACCATTATGAGA GAAATACCGTTTACTTGTATACAGTTTCCTTTATACGAGTATCTAAAAAAGACTTGGGCA AAAGCCAATGGCCAAAGTCAAGTGGAGCCATGGAAAGGGGCTATCTGCGGTTCTATTGCG GGTGGGATCGCAGCAGCTACAACGACACCATTAGATTTCTTGAAAACCAGATTAATGCTC AACAAAACAACCGCCTCACTTGGAAGCGTTATTATTAGGATTTACAGAGAGGAAGGTCCT GCTGTATTTTTCAGTGGAGTGGGGCCCCGGACAATGTGGATCAGTGCAGGTGGTGCTATC TTCCTAGGCATGTATGAAACTGTTCATTCGTTATTATCGAAAAGTTTCCCAACGGCTGGA GAAATGAGAGCGTAA
Protein Properties
Pfam Domain Function
Protein Residues284
Protein Molecular Weight31026.59961
Protein Theoretical pI10.09
Signalling Regions
  • None
Transmembrane Regions
  • 5-25
  • 50-70
  • 98-118
  • 153-169
  • 194-214
  • 252-272
Protein Sequence>Putative mitochondrial carrier protein PET8 MNTFFLSLLSGAAAGTSTDLVFFPIDTIKTRLQAKGGFFANGGYKGIYRGLGSAVVASAP GASLFFISYDYMKVKSRPYISKLYSQGSEQLIDTTTHMLSSSIGEICACLVRVPAEVVKQ RTQVHSTNSSWQTLQSILRNDNKEGLRKNLYRGWSTTIMREIPFTCIQFPLYEYLKKTWA KANGQSQVEPWKGAICGSIAGGIAAATTTPLDFLKTRLMLNKTTASLGSVIIRIYREEGP AVFFSGVGPRTMWISAGGAIFLGMYETVHSLLSKSFPTAGEMRA
References
External Links
ResourceLink
Saccharomyces Genome Database PET8
Uniprot IDP38921
Uniprot NamePET8_YEAST
GenBank Gene IDU02536
Genebank Protein ID495307
General Reference
  • Lalo, D., Stettler, S., Mariotte, S., Slonimski, P. P., Thuriaux, P. (1993). "Two yeast chromosomes are related by a fossil duplication of their centromeric regions." C R Acad Sci III 316:367-373.8402262
  • Lalo, D., Stettler, S., Mariotte, S., Gendreau, E., Thuriaux, P. (1994). "Organization of the centromeric region of chromosome XIV in Saccharomyces cerevisiae." Yeast 10:523-533.7941739
  • Verhasselt, P., Aert, R., Voet, M., Volckaert, G. (1994). "Nucleotide sequence analysis of an 8887 bp region of the left arm of yeast chromosome XIV, encompassing the centromere sequence." Yeast 10:945-951.7985421
  • Philippsen, P., Kleine, K., Pohlmann, R., Dusterhoft, A., Hamberg, K., Hegemann, J. H., Obermaier, B., Urrestarazu, L. A., Aert, R., Albermann, K., Altmann, R., Andre, B., Baladron, V., Ballesta, J. P., Becam, A. M., Beinhauer, J., Boskovic, J., Buitrago, M. J., Bussereau, F., Coster, F., Crouzet, M., D'Angelo, M., Dal Pero, F., De Antoni, A., Del Rey, F., Doignon, F., Domdey, H., Dubois, E., Fiedler, T., Fleig, U., Floeth, M., Fritz, C., Gaillardin, C., Garcia-Cantalejo, J. M., Glansdorff, N. N., Goffeau, A., Gueldener, U., Herbert, C., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hinni, K., Iraqui Houssaini, I., Jacquet, M., Jimenez, A., Jonniaux, J. L., Karpfinger, L., Lanfranchi, G., Lepingle, A., Levesque, H., Lyck, R., Maftahi, M., Mallet, L., Maurer, K. C., Messenguy, F., Mewes, H. W., Mosti, D., Nasr, F., Nicaud, J. M., Niedenthal, R. K., Pandolfo, D., Pierard, A., Piravandi, E., Planta, R. J., Pohl, T. M., Purnelle, B., Rebischung, C., Remacha, M., Revuelta, J. L., Rinke, M., Saiz, J. E., Sartorello, F., Scherens, B., Sen-Gupta, M., Soler-Mira, A., Urbanus, J. H., Valle, G., Van Dyck, L., Verhasselt, P., Vierendeels, F., Vissers, S., Voet, M., Volckaert, G., Wach, A., Wambutt, R., Wedler, H., Zollner, A., Hani, J. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIV and its evolutionary implications." Nature 387:93-98.9169873
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106