You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePeptidyl-tRNA hydrolase
Synonyms
  • PTH
Gene NamePTH1
Enzyme Class
Biological Properties
General FunctionInvolved in aminoacyl-tRNA hydrolase activity
Specific FunctionN-substituted aminoacyl-tRNA + H(2)O = N- substituted amino acid + tRNA
Cellular LocationMitochondrion
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00890waterShow
GO Classification
Component
Not Available
Function
hydrolase activity
hydrolase activity, acting on ester bonds
carboxylesterase activity
aminoacyl-tRNA hydrolase activity
catalytic activity
Process
metabolic process
biosynthetic process
macromolecule biosynthetic process
cellular macromolecule biosynthetic process
translation
Gene Properties
Chromosome Locationchromosome 8
LocusYHR189W
Gene Sequence>573 bp ATGTCCGGTAAATGGAGACTAGTGCTGACCGGGATAGGCAATCCAGAGCCTCAGTACGCT GGTACCCGTCACAATGTAGGGCTATATATGCTGGAGCTGCTACGAAAGCGGCTTGGTCTG CAGGGGAGAACTTATTCCCCTGTGCCTAATACGGGCGGCAAAGTGCATTATATAGAAGAC GAACATTGTACGATACTAAGATCGGATGGCCAGTACATGAATCTAAGTGGAGAACAGGTG TGCAAGGTCTGGGCCCGGTACGCCAAGTACCAAGCCCGACACGTAGTTATTCATGACGAG TTAAGTGTGGCGTGTGGAAAAGTGCAGCTCAGAGCCCCCAGCACCAGTATTAGAGGTCAT AATGGGCTGCGAAGCCTGCTAAAATGCAGTGGAGGCCGTGTACCCTTTGCCAAATTGGCT ATTGGAATCGGCAGAGAACCTGGGTCCCGTTCTAGAGACCCTGCGAGCGTGTCCCGGTGG GTTCTGGGAGCTCTAACTCCGCAGGAACTACAAACCTTGCTTACACAGAGTGAACCTGCT GCCTGGCGTGCTCTGACTCAGTACATTTCATAG
Protein Properties
Pfam Domain Function
Protein Residues190
Protein Molecular Weight21036.0
Protein Theoretical pI10.32
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Peptidyl-tRNA hydrolase MSGKWRLVLTGIGNPEPQYAGTRHNVGLYMLELLRKRLGLQGRTYSPVPNTGGKVHYIED EHCTILRSDGQYMNLSGEQVCKVWARYAKYQARHVVIHDELSVACGKVQLRAPSTSIRGH NGLRSLLKCSGGRVPFAKLAIGIGREPGSRSRDPASVSRWVLGALTPQELQTLLTQSEPA AWRALTQYIS
References
External Links
ResourceLink
Saccharomyces Genome Database PTH1
Uniprot IDP38876
Uniprot NamePTH_YEAST
GenBank Gene IDU00030
Genebank Protein ID458935
General Reference
  • Johnston, M., Andrews, S., Brinkman, R., Cooper, J., Ding, H., Dover, J., Du, Z., Favello, A., Fulton, L., Gattung, S., et, a. l. .. (1994). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome VIII." Science 265:2077-2082.8091229
  • Ouzounis, C., Bork, P., Casari, G., Sander, C. (1995). "New protein functions in yeast chromosome VIII." Protein Sci 4:2424-2428.8563640
  • Rosas-Sandoval, G., Ambrogelly, A., Rinehart, J., Wei, D., Cruz-Vera, L. R., Graham, D. E., Stetter, K. O., Guarneros, G., Soll, D. (2002). "Orthologs of a novel archaeal and of the bacterial peptidyl-tRNA hydrolase are nonessential in yeast." Proc Natl Acad Sci U S A 99:16707-16712.12475929
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Fromant, M., Ferri-Fioni, M. L., Plateau, P., Blanquet, S. (2003). "Peptidyl-tRNA hydrolase from Sulfolobus solfataricus." Nucleic Acids Res 31:3227-3235.12799450