You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
Name6-phosphogluconolactonase 3
Synonyms
  • 6PGL
Gene NameSOL3
Enzyme Class
Biological Properties
General FunctionInvolved in 6-phosphogluconolactonase activity
Specific FunctionHydrolysis of 6-phosphogluconolactone to 6- phosphogluconate
Cellular LocationCytoplasm. Nucleus
SMPDB PathwaysNot Available
KEGG Pathways
Pentose phosphate pathwayec00030 Map00030
SMPDB ReactionsNot Available
KEGG Reactions
water + 6-Phosphonoglucono-D-lactone6-Phosphogluconic acid + hydron
Metabolites
YMDB IDNameView
YMDB001406-Phosphonoglucono-D-lactoneShow
YMDB002186-Phosphogluconic acidShow
YMDB00862hydronShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
hydrolase activity
hydrolase activity, acting on ester bonds
catalytic activity
carboxylesterase activity
6-phosphogluconolactonase activity
Process
hexose metabolic process
metabolic process
glucose metabolic process
glucose catabolic process
primary metabolic process
pentose-phosphate shunt
carbohydrate metabolic process
small molecule metabolic process
alcohol metabolic process
monosaccharide metabolic process
Gene Properties
Chromosome Locationchromosome 8
LocusYHR163W
Gene Sequence>YHR163W SOL3 SGDID:S000001206, Chr VIII from 423724-424473, Verified ORF, "6-phosphogluconolactonase, catalyzes the second step of the pentose phosphate pathway; weak multicopy suppressor of los1-1 mutation; homologous to Sol2p and Sol1p" ATGGTGACAGTCGGTGTGTTTTCTGAGAGGGCTAGTTTGACCCATCAATTGGGGGAATTC ATCGTCAAGAAACAAGATGAGGCGCTGCAAAAGAAGTCAGACTTTAAAGTTTCCGTTAGC GGTGGCTCTTTGATCGATGCTCTGTATGAAAGTTTAGTAGCGGACGAATCACTATCTTCT CGAGTGCAATGGTCTAAATGGCAAATCTACTTCTCTGATGAAAGAATTGTGCCACTGACG GACGCTGACAGCAATTATGGTGCCTTCAAGAGAGCTGTTCTAGATAAATTACCCTCGACT AGTCAGCCAAACGTTTATCCCATGGACGAGTCCTTGATTGGCAGCGATGCTGAATCTAAC AACAAAATTGCTGCAGAGTACGAGCGTATCGTACCTCAAGTGCTTGATTTGGTACTGTTG GGCTGTGGTCCTGATGGACACACTTGTTCCTTATTCCCTGGAGAAACACATAGGTACTTG CTGAACGAAACAACCAAAAGAGTTGCTTGGTGCCACGATTCTCCCAAGCCTCCAAGTGAC AGAATCACCTTCACTCTGCCTGTGTTGAAAGACGCCAAAGCCCTGTGTTTTGTGGCTGAG GGCAGTTCCAAACAAAATATAATGCATGAGATCTTTGACTTGAAAAACGATCAATTGCCA ACCGCATTGGTTAACAAATTATTTGGTGAAAAAACATCCTGGTTCGTTAATGAGGAAGCT TTTGGAAAAGTTCAAACGAAAACTTTTTAG
Protein Properties
Pfam Domain FunctionNot Available
Protein Residues249
Protein Molecular Weight27784.19922
Protein Theoretical pI5.17
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>6-phosphogluconolactonase 3 MVTVGVFSERASLTHQLGEFIVKKQDEALQKKSDFKVSVSGGSLIDALYESLVADESLSS RVQWSKWQIYFSDERIVPLTDADSNYGAFKRAVLDKLPSTSQPNVYPMDESLIGSDAESN NKIAAEYERIVPQVLDLVLLGCGPDGHTCSLFPGETHRYLLNETTKRVAWCHDSPKPPSD RITFTLPVLKDAKALCFVAEGSSKQNIMHEIFDLKNDQLPTALVNKLFGEKTSWFVNEEA FGKVQTKTF
References
External Links
ResourceLink
Saccharomyces Genome Database SOL3
Uniprot IDP38858
Uniprot NameSOL3_YEAST
General Reference
  • Shen, W. C., Stanford, D. R., Hopper, A. K. (1996). "Los1p, involved in yeast pre-tRNA splicing, positively regulates members of the SOL gene family." Genetics 143:699-712.8725220
  • Johnston, M., Andrews, S., Brinkman, R., Cooper, J., Ding, H., Dover, J., Du, Z., Favello, A., Fulton, L., Gattung, S., et, a. l. .. (1994). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome VIII." Science 265:2077-2082.8091229
  • Kellis, M., Patterson, N., Endrizzi, M., Birren, B., Lander, E. S. (2003). "Sequencing and comparison of yeast species to identify genes and regulatory elements." Nature 423:241-254.12748633
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Stanford, D. R., Whitney, M. L., Hurto, R. L., Eisaman, D. M., Shen, W. C., Hopper, A. K. (2004). "Division of labor among the yeast Sol proteins implicated in tRNA nuclear export and carbohydrate metabolism." Genetics 168:117-127.15454531
  • Zhang, Z., Dietrich, F. S. (2005). "Mapping of transcription start sites in Saccharomyces cerevisiae using 5' SAGE." Nucleic Acids Res 33:2838-2851.15905473