You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameAromatic amino acid aminotransferase 2
Synonyms
  • Aromatic amino acid aminotransferase II
  • Aromatic amino acid-requiring protein 9
Gene NameARO9
Enzyme Class
Biological Properties
General FunctionInvolved in transferase activity, transferring nitrogenous groups
Specific FunctionHas aromatic amino acid transaminase activity and kynurenine aminotransferase activity
Cellular LocationCytoplasm
SMPDB Pathways
Methionine metabolism and salvagePW002384 ThumbThumb?image type=greyscaleThumb?image type=simple
Phenylalanine metabolismPW002437 ThumbThumb?image type=greyscaleThumb?image type=simple
Tryptophan metabolismPW002442 ThumbThumb?image type=greyscaleThumb?image type=simple
Tyrosine metabolismPW002441 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Tyrosine metabolismec00350 Map00350
SMPDB Reactions
4-Methylthio-2-oxobutanoate + L-PhenylalanineL-Methionine + 2-Ketobutyric acid
keto-phenylpyruvic acid + L-AlaninePyruvic acid + L-Phenylalanine
(4-hydroxyphenyl)pyruvic acid + L-AlaninePyruvic acid + L-Tyrosine
L-Tryptophan + keto-phenylpyruvic acid3-(indol-3-yl)pyruvate + L-Phenylalanine
KEGG Reactions
Oxoglutaric acid + L-PhenylalanineL-Glutamic acid + keto-phenylpyruvic acid
Oxoglutaric acid + L-TryptophanL-Glutamic acid + 3-(indol-3-yl)pyruvic acid
L-Glutamic acid + (4-hydroxyphenyl)pyruvic acidL-Tyrosine + Oxoglutaric acid
Metabolites
YMDB IDNameView
YMDB000712-Ketobutyric acidShow
YMDB00126L-TryptophanShow
YMDB00153Oxoglutaric acidShow
YMDB00154L-AlanineShow
YMDB001693-(indol-3-yl)pyruvic acidShow
YMDB00175Pyruvic acidShow
YMDB00271L-Glutamic acidShow
YMDB00304L-PhenylalanineShow
YMDB00318L-MethionineShow
YMDB00364L-TyrosineShow
YMDB004214-Methylthio-2-oxobutanoateShow
YMDB00786keto-phenylpyruvic acidShow
YMDB00958(4-hydroxyphenyl)pyruvic acidShow
YMDB010693-(indol-3-yl)pyruvateShow
GO Classification
Component
Not Available
Function
transferase activity, transferring nitrogenous groups
cofactor binding
pyridoxal phosphate binding
catalytic activity
transferase activity
binding
Process
metabolic process
biosynthetic process
Gene Properties
Chromosome Locationchromosome 8
LocusYHR137W
Gene Sequence>1542 bp ATGACTGCTGGTTCTGCCCCCCCTGTTGATTACACTTCCTTAAAGAAGAACTTCCAACCG TTTCTCTCCAGAAGAGTAGAAAATAGATCTCTGAAAAGCTTTTGGGATGCTTCTGATATC TCAGATGACGTCATTGAGCTAGCTGGTGGAATGCCAAACGAGAGATTTTTTCCTATCGAA TCTATGGATTTGAAAATATCAAAAGTTCCTTTTAATGATAACCCAAAATGGCATAATTCG TTTACCACGGCGCATTTGGACTTGGGATCCCCCAGTGAGCTACCCATTGCACGTTCTTTC CAATATGCAGAAACCAAGGGTTTACCCCCTCTCTTACATTTTGTTAAAGATTTTGTGTCC AGAATTAATCGCCCAGCCTTTTCCGATGAGACGGAGTCTAACTGGGATGTCATCCTTTCT GGCGGGTCCAACGATTCAATGTTTAAGGTTTTTGAAACAATTTGCGACGAATCGACCACT GTGATGATTGAAGAGTTTACTTTCACCCCGGCTATGTCCAATGTGGAGGCTACAGGAGCA AAAGTCATCCCCATCAAGATGAACCTGACCTTCGACAGAGAGTCCCAGGGTATTGATGTC GAATATCTAACGCAGTTGCTCGATAATTGGTCAACTGGACCATACAAAGACTTAAACAAG CCAAGGGTCCTATATACCATTGCAACGGGCCAAAATCCTACCGGGATGTCTGTCCCCCAG TGGAAAAGAGAGAAAATTTACCAGTTGGCCCAAAGACACGATTTCCTCATTGTTGAAGAT GATCCCTACGGTTATCTGTACTTTCCTTCCTATAATCCGCAAGAGCCATTAGAAAACCCT TACCATTCTAGCGACCTGACTACTGAACGGTATTTGAATGATTTTTTAATGAAATCATTC TTGACTTTGGATACAGATGCCCGTGTCATCCGTTTGGAGACTTTTTCTAAAATTTTTGCT CCTGGATTAAGGTTATCCTTCATCGTTGCTAATAAATTCCTTTTGCAAAAAATCTTGGAT TTGGCCGACATTACTACAAGGGCCCCCAGTGGTACCTCACAAGCTATTGTTTATTCTACA ATAAAGGCAATGGCTGAGTCCAACTTATCGTCCTCTCTTTCTATGAAAGAAGCAATGTTT GAGGGTTGGATAAGATGGATAATGCAGATTGCTTCTAAATACAATCATAGGAAAAATCTT ACTTTGAAAGCCTTATACGAAACAGAATCTTACCAAGCTGGTCAGTTTACCGTTATGGAA CCCTCCGCGGGTATGTTCATCATTATTAAAATCAATTGGGGGAATTTCGATAGACCTGAC GATTTGCCGCAACAGATGGATATTTTAGATAAGTTCTTGCTGAAGAATGGTGTTAAAGTA GTGCTTGGTTATAAAATGGCTGTTTGCCCAAATTATTCAAAGCAGAATTCAGATTTTCTA AGACTCACCATCGCCTATGCAAGGGATGATGATCAGTTGATTGAAGCTTCCAAAAGAATC GGTAGTGGCATAAAAGAATTTTTTGACAACTATAAAAGTTGA
Protein Properties
Pfam Domain Function
Protein Residues513
Protein Molecular Weight58527.0
Protein Theoretical pI5.16
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Aromatic amino acid aminotransferase 2 MTAGSAPPVDYTSLKKNFQPFLSRRVENRSLKSFWDASDISDDVIELAGGMPNERFFPIE SMDLKISKVPFNDNPKWHNSFTTAHLDLGSPSELPIARSFQYAETKGLPPLLHFVKDFVS RINRPAFSDETESNWDVILSGGSNDSMFKVFETICDESTTVMIEEFTFTPAMSNVEATGA KVIPIKMNLTFDRESQGIDVEYLTQLLDNWSTGPYKDLNKPRVLYTIATGQNPTGMSVPQ WKREKIYQLAQRHDFLIVEDDPYGYLYFPSYNPQEPLENPYHSSDLTTERYLNDFLMKSF LTLDTDARVIRLETFSKIFAPGLRLSFIVANKFLLQKILDLADITTRAPSGTSQAIVYST IKAMAESNLSSSLSMKEAMFEGWIRWIMQIASKYNHRKNLTLKALYETESYQAGQFTVME PSAGMFIIIKINWGNFDRPDDLPQQMDILDKFLLKNGVKVVLGYKMAVCPNYSKQNSDFL RLTIAYARDDDQLIEASKRIGSGIKEFFDNYKS
References
External Links
ResourceLink
Saccharomyces Genome Database ARO9
Uniprot IDP38840
Uniprot NameARO9_YEAST
GenBank Gene IDU10398
Genebank Protein ID500670
General Reference
  • Iraqui, I., Vissers, S., Cartiaux, M., Urrestarazu, A. (1998). "Characterisation of Saccharomyces cerevisiae ARO8 and ARO9 genes encoding aromatic aminotransferases I and II reveals a new aminotransferase subfamily." Mol Gen Genet 257:238-248.9491083
  • Johnston, M., Andrews, S., Brinkman, R., Cooper, J., Ding, H., Dover, J., Du, Z., Favello, A., Fulton, L., Gattung, S., et, a. l. .. (1994). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome VIII." Science 265:2077-2082.8091229
  • Urrestarazu, A., Vissers, S., Iraqui, I., Grenson, M. (1998). "Phenylalanine- and tyrosine-auxotrophic mutants of Saccharomyces cerevisiae impaired in transamination." Mol Gen Genet 257:230-237.9491082
  • Iraqui, I., Vissers, S., Andre, B., Urrestarazu, A. (1999). "Transcriptional induction by aromatic amino acids in Saccharomyces cerevisiae." Mol Cell Biol 19:3360-3371.10207060
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956