You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePhosphatidylglycerophosphatase GEP4, mitochondrial
Synonyms
  • Genetic interactor of prohibitins 4
  • PGP phosphatase GEP4
Gene NameGEP4
Enzyme Class
Biological Properties
General FunctionInvolved in phosphatidylglycerophosphatase activity
Specific FunctionPhosphatidylglycerophosphatase involved in the biosynthesis of cardiolipin (CL), a unique dimeric phosphoglycerolipid predominantly present in mitochondrial membranes and which has important functions for cellular energy metabolism, mitochondrial dynamics and the initiation of apoptotic pathways. Required for the stability of respiratory chain supercomplexes and for growth at elevated temperature, in presence of ethidium bromide or in absence of prohibitins
Cellular LocationMitochondrion inner membrane; Peripheral membrane protein; Matrix side
SMPDB Pathways
Cardiolipin BiosynthesisPW002431 ThumbThumb?image type=greyscaleThumb?image type=simple
Cardiolipin Biosynthesis CL(10:0/10:0/10:0/28:0)PW003484 ThumbThumb?image type=greyscaleThumb?image type=simple
Cardiolipin Biosynthesis CL(10:0/10:0/10:0/30:0)PW003501 ThumbThumb?image type=greyscaleThumb?image type=simple
Cardiolipin Biosynthesis CL(10:0/10:0/12:0/26:0)PW003502 ThumbThumb?image type=greyscaleThumb?image type=simple
Cardiolipin Biosynthesis CL(10:0/10:0/12:0/28:0)PW003503 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Glycerophospholipid metabolismec00564 Map00564
SMPDB Reactions
PGP(10:0/22:1(9Z)) + waterphosphate + PG(10:0/22:1(9Z))
PGP(10:0/23:1(11Z)) + waterphosphate + PG(10:0/23:1(11Z))
PGP(10:0/23:1(9Z)) + waterphosphate + PG(10:0/23:1(9Z))
PGP(10:0/24:0) + waterphosphate + PG(10:0/24:0)
PGP(10:0/24:1(11Z)) + waterphosphate + PG(10:0/24:1(11Z))
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00890waterShow
YMDB00907phosphateShow
YMDB01209PG(16:0/16:1(9Z))Show
YMDB01210PG(16:0/18:1(9Z))Show
YMDB01211PG(16:1(9Z)/16:1(9Z))Show
YMDB01214PG(18:1(9Z)/18:1(9Z))Show
YMDB14166PGP(10:0/20:0)Show
YMDB14167PGP(10:0/20:1(11Z))Show
YMDB14168PGP(10:0/20:1(13Z))Show
YMDB14169PGP(10:0/22:0)Show
YMDB14170PGP(10:0/22:1(11Z))Show
YMDB14171PGP(10:0/22:1(9Z))Show
YMDB14172PGP(10:0/23:1(11Z))Show
YMDB14173PGP(10:0/23:1(9Z))Show
YMDB14174PGP(10:0/24:0)Show
YMDB14175PGP(10:0/24:1(11Z))Show
YMDB14176PGP(10:0/24:1(9Z))Show
YMDB14177PGP(10:0/25:0)Show
YMDB14178PGP(10:0/25:1(11Z))Show
YMDB14179PGP(10:0/25:1(9Z))Show
YMDB14180PGP(10:0/26:0)Show
YMDB14181PGP(10:0/26:1(11Z))Show
YMDB14182PGP(10:0/26:1(9Z))Show
YMDB14184PGP(12:0/18:0)Show
YMDB14185PGP(12:0/18:1(11Z))Show
YMDB14186PGP(12:0/18:1(9Z))Show
YMDB14187PGP(12:0/20:0)Show
YMDB14188PGP(12:0/20:1(11Z))Show
YMDB14189PGP(12:0/20:1(13Z))Show
YMDB14190PGP(12:0/22:0)Show
YMDB14191PGP(12:0/22:1(11Z))Show
YMDB14192PGP(12:0/22:1(9Z))Show
YMDB14193PGP(12:0/23:1(11Z))Show
YMDB14194PGP(12:0/23:1(9Z))Show
YMDB14195PGP(12:0/24:0)Show
YMDB14196PGP(12:0/24:1(11Z))Show
YMDB14197PGP(12:0/24:1(9Z))Show
YMDB14205PGP(14:0/15:0)Show
YMDB14206PGP(14:0/16:0)Show
YMDB14207PGP(14:0/16:1(11Z))Show
YMDB14208PGP(14:0/16:1(9Z))Show
YMDB14209PGP(14:0/18:0)Show
YMDB14210PGP(14:0/18:1(11Z))Show
YMDB14211PGP(14:0/18:1(9Z))Show
YMDB14212PGP(14:0/20:0)Show
YMDB14213PGP(14:0/20:1(11Z))Show
YMDB14214PGP(14:0/20:1(13Z))Show
YMDB14215PGP(14:0/22:0)Show
YMDB14216PGP(14:0/22:1(11Z))Show
YMDB14217PGP(14:0/22:1(9Z))Show
YMDB14228PGP(14:1(11Z)/16:0)Show
YMDB14229PGP(14:1(11Z)/16:1(11Z))Show
YMDB14230PGP(14:1(11Z)/16:1(9Z))Show
YMDB14231PGP(14:1(11Z)/18:0)Show
YMDB14232PGP(14:1(11Z)/18:1(11Z))Show
YMDB14233PGP(14:1(11Z)/18:1(9Z))Show
YMDB14234PGP(14:1(11Z)/20:0)Show
YMDB14235PGP(14:1(11Z)/20:1(11Z))Show
YMDB14236PGP(14:1(11Z)/20:1(13Z))Show
YMDB14237PGP(14:1(11Z)/22:0)Show
YMDB14238PGP(14:1(11Z)/22:1(11Z))Show
YMDB14239PGP(14:1(11Z)/22:1(9Z))Show
YMDB14250PGP(14:1(9Z)/16:0)Show
YMDB14251PGP(14:1(9Z)/16:1(11Z))Show
YMDB14252PGP(14:1(9Z)/16:1(9Z))Show
YMDB14253PGP(14:1(9Z)/18:0)Show
YMDB14254PGP(14:1(9Z)/18:1(11Z))Show
YMDB14255PGP(14:1(9Z)/18:1(9Z))Show
YMDB14256PGP(14:1(9Z)/20:0)Show
YMDB14257PGP(14:1(9Z)/20:1(11Z))Show
YMDB14258PGP(14:1(9Z)/20:1(13Z))Show
YMDB14259PGP(14:1(9Z)/22:0)Show
YMDB14260PGP(14:1(9Z)/22:1(11Z))Show
YMDB14261PGP(14:1(9Z)/22:1(9Z))Show
YMDB14272PGP(15:0/15:0)Show
YMDB14273PGP(15:0/15:1(11Z))Show
YMDB14274PGP(15:0/15:1(9Z))Show
YMDB14275PGP(15:0/16:0)Show
YMDB14276PGP(15:0/16:1(11Z))Show
YMDB14277PGP(15:0/16:1(9Z))Show
YMDB14278PGP(15:0/18:0)Show
YMDB14279PGP(15:0/18:1(11Z))Show
YMDB14280PGP(15:0/18:1(9Z))Show
YMDB14281PGP(15:0/20:0)Show
YMDB14282PGP(15:0/20:1(11Z))Show
YMDB14283PGP(15:0/20:1(13Z))Show
YMDB14306PGP(15:1(11Z)/15:1(11Z))Show
YMDB14307PGP(15:1(11Z)/15:1(9Z))Show
YMDB14308PGP(15:1(11Z)/16:0)Show
YMDB14309PGP(15:1(11Z)/16:1(11Z))Show
YMDB14310PGP(15:1(11Z)/16:1(9Z))Show
YMDB14311PGP(15:1(11Z)/18:0)Show
YMDB14312PGP(15:1(11Z)/18:1(11Z))Show
YMDB14313PGP(15:1(11Z)/18:1(9Z))Show
YMDB14314PGP(15:1(11Z)/20:0)Show
YMDB14315PGP(15:1(11Z)/20:1(11Z))Show
YMDB14316PGP(15:1(11Z)/20:1(13Z))Show
YMDB14339PGP(15:1(9Z)/15:1(11Z))Show
YMDB14340PGP(15:1(9Z)/15:1(9Z))Show
YMDB14341PGP(15:1(9Z)/16:0)Show
YMDB14342PGP(15:1(9Z)/16:1(11Z))Show
YMDB14343PGP(15:1(9Z)/16:1(9Z))Show
YMDB14344PGP(15:1(9Z)/18:0)Show
YMDB14345PGP(15:1(9Z)/18:1(11Z))Show
YMDB14346PGP(15:1(9Z)/18:1(9Z))Show
YMDB14347PGP(15:1(9Z)/20:0)Show
YMDB14348PGP(15:1(9Z)/20:1(11Z))Show
YMDB14349PGP(15:1(9Z)/20:1(13Z))Show
YMDB14372PGP(16:0/16:0)Show
YMDB14373PGP(16:0/16:1(11Z))Show
YMDB14374PGP(16:0/16:1(9Z))Show
YMDB14375PGP(16:0/18:0)Show
YMDB14376PGP(16:0/18:1(11Z))Show
YMDB14377PGP(16:0/18:1(9Z))Show
YMDB14378PGP(16:0/20:0)Show
YMDB14379PGP(16:0/20:1(11Z))Show
YMDB14380PGP(16:0/20:1(13Z))Show
YMDB14403PGP(16:1(11Z)/16:1(11Z))Show
YMDB14404PGP(16:1(11Z)/16:1(9Z))Show
YMDB14405PGP(16:1(11Z)/18:0)Show
YMDB14406PGP(16:1(11Z)/18:1(11Z))Show
YMDB14407PGP(16:1(11Z)/18:1(9Z))Show
YMDB14408PGP(16:1(11Z)/20:0)Show
YMDB14409PGP(16:1(11Z)/20:1(11Z))Show
YMDB14410PGP(16:1(11Z)/20:1(13Z))Show
YMDB14433PGP(16:1(9Z)/16:1(11Z))Show
YMDB14434PGP(16:1(9Z)/16:1(9Z))Show
YMDB14519PGP(18:1(9Z)/18:1(9Z))Show
YMDB14735PG(10:0/20:0)Show
YMDB14736PG(10:0/20:1(11Z))Show
YMDB14737PG(10:0/20:1(13Z))Show
YMDB14738PG(10:0/22:0)Show
YMDB14739PG(10:0/22:1(11Z))Show
YMDB14740PG(10:0/22:1(9Z))Show
YMDB14741PG(10:0/23:1(11Z))Show
YMDB14742PG(10:0/23:1(9Z))Show
YMDB14743PG(10:0/24:0)Show
YMDB14744PG(10:0/24:1(11Z))Show
YMDB14745PG(10:0/24:1(9Z))Show
YMDB14746PG(10:0/25:0)Show
YMDB14747PG(10:0/25:1(11Z))Show
YMDB14748PG(10:0/25:1(9Z))Show
YMDB14749PG(10:0/26:0)Show
YMDB14750PG(10:0/26:1(11Z))Show
YMDB14751PG(10:0/26:1(9Z))Show
YMDB14753PG(12:0/18:0)Show
YMDB14754PG(12:0/18:1(11Z))Show
YMDB14755PG(12:0/18:1(9Z))Show
YMDB14756PG(12:0/20:0)Show
YMDB14757PG(12:0/20:1(11Z))Show
YMDB14758PG(12:0/20:1(13Z))Show
YMDB14759PG(12:0/22:0)Show
YMDB14760PG(12:0/22:1(11Z))Show
YMDB14761PG(12:0/22:1(9Z))Show
YMDB14762PG(12:0/23:1(11Z))Show
YMDB14763PG(12:0/23:1(9Z))Show
YMDB14764PG(12:0/24:0)Show
YMDB14765PG(12:0/24:1(11Z))Show
YMDB14766PG(12:0/24:1(9Z))Show
YMDB14774PG(14:0/15:0)Show
YMDB14775PG(14:0/16:0)Show
YMDB14776PG(14:0/16:1(11Z))Show
YMDB14777PG(14:0/16:1(9Z))Show
YMDB14778PG(14:0/18:0)Show
YMDB14779PG(14:0/18:1(11Z))Show
YMDB14780PG(14:0/18:1(9Z))Show
YMDB14781PG(14:0/20:0)Show
YMDB14782PG(14:0/20:1(11Z))Show
YMDB14783PG(14:0/20:1(13Z))Show
YMDB14784PG(14:0/22:0)Show
YMDB14785PG(14:0/22:1(11Z))Show
YMDB14786PG(14:0/22:1(9Z))Show
YMDB14797PG(14:1(11Z)/16:0)Show
YMDB14798PG(14:1(11Z)/16:1(11Z))Show
YMDB14799PG(14:1(11Z)/16:1(9Z))Show
YMDB14800PG(14:1(11Z)/18:0)Show
YMDB14801PG(14:1(11Z)/18:1(11Z))Show
YMDB14802PG(14:1(11Z)/18:1(9Z))Show
YMDB14803PG(14:1(11Z)/20:0)Show
YMDB14804PG(14:1(11Z)/20:1(11Z))Show
YMDB14805PG(14:1(11Z)/20:1(13Z))Show
YMDB14806PG(14:1(11Z)/22:0)Show
YMDB14807PG(14:1(11Z)/22:1(11Z))Show
YMDB14808PG(14:1(11Z)/22:1(9Z))Show
YMDB14819PG(14:1(9Z)/16:0)Show
YMDB14820PG(14:1(9Z)/16:1(11Z))Show
YMDB14821PG(14:1(9Z)/16:1(9Z))Show
YMDB14822PG(14:1(9Z)/18:0)Show
YMDB14823PG(14:1(9Z)/18:1(11Z))Show
YMDB14824PG(14:1(9Z)/18:1(9Z))Show
YMDB14825PG(14:1(9Z)/20:0)Show
YMDB14826PG(14:1(9Z)/20:1(11Z))Show
YMDB14827PG(14:1(9Z)/20:1(13Z))Show
YMDB14828PG(14:1(9Z)/22:0)Show
YMDB14829PG(14:1(9Z)/22:1(11Z))Show
YMDB14830PG(14:1(9Z)/22:1(9Z))Show
YMDB14841PG(15:0/15:0)Show
YMDB14842PG(15:0/15:1(11Z))Show
YMDB14843PG(15:0/15:1(9Z))Show
YMDB14844PG(15:0/16:0)Show
YMDB14845PG(15:0/16:1(11Z))Show
YMDB14846PG(15:0/16:1(9Z))Show
YMDB14847PG(15:0/18:0)Show
YMDB14848PG(15:0/18:1(11Z))Show
YMDB14849PG(15:0/18:1(9Z))Show
YMDB14850PG(15:0/20:0)Show
YMDB14851PG(15:0/20:1(11Z))Show
YMDB14852PG(15:0/20:1(13Z))Show
YMDB14875PG(15:1(11Z)/15:1(11Z))Show
YMDB14876PG(15:1(11Z)/15:1(9Z))Show
YMDB14877PG(15:1(11Z)/16:0)Show
YMDB14878PG(15:1(11Z)/16:1(11Z))Show
YMDB14879PG(15:1(11Z)/16:1(9Z))Show
YMDB14880PG(15:1(11Z)/18:0)Show
YMDB14881PG(15:1(11Z)/18:1(11Z))Show
YMDB14882PG(15:1(11Z)/18:1(9Z))Show
YMDB14883PG(15:1(11Z)/20:0)Show
YMDB14884PG(15:1(11Z)/20:1(11Z))Show
YMDB14885PG(15:1(11Z)/20:1(13Z))Show
YMDB14908PG(15:1(9Z)/15:1(11Z))Show
YMDB14909PG(15:1(9Z)/15:1(9Z))Show
YMDB14910PG(15:1(9Z)/16:0)Show
YMDB14911PG(15:1(9Z)/16:1(11Z))Show
YMDB14912PG(15:1(9Z)/16:1(9Z))Show
YMDB14913PG(15:1(9Z)/18:0)Show
YMDB14914PG(15:1(9Z)/18:1(11Z))Show
YMDB14915PG(15:1(9Z)/18:1(9Z))Show
YMDB14916PG(15:1(9Z)/20:0)Show
YMDB14917PG(15:1(9Z)/20:1(11Z))Show
YMDB14918PG(15:1(9Z)/20:1(13Z))Show
YMDB14941PG(16:0/16:0)Show
YMDB14942PG(16:0/16:1(11Z))Show
YMDB14943PG(16:0/18:0)Show
YMDB14944PG(16:0/18:1(11Z))Show
YMDB14945PG(16:0/20:0)Show
YMDB14946PG(16:0/20:1(11Z))Show
YMDB14947PG(16:0/20:1(13Z))Show
YMDB14970PG(16:1(11Z)/16:1(11Z))Show
YMDB14971PG(16:1(11Z)/16:1(9Z))Show
YMDB14972PG(16:1(11Z)/18:0)Show
YMDB14973PG(16:1(11Z)/18:1(11Z))Show
YMDB14974PG(16:1(11Z)/18:1(9Z))Show
YMDB14975PG(16:1(11Z)/20:0)Show
YMDB14976PG(16:1(11Z)/20:1(11Z))Show
YMDB14977PG(16:1(11Z)/20:1(13Z))Show
YMDB15000PG(16:1(9Z)/16:1(11Z))Show
YMDB16266PG(14:0/14:0)Show
YMDB16271PG(12:0/12:0)Show
YMDB16287PGP(12:0/12:0)Show
YMDB16288PGP(14:0/14:0)Show
YMDB16289PG(10:0/10:0)Show
YMDB16290PGP(10:0/10:0)Show
GO ClassificationNot Available
Gene Properties
Chromosome Locationchromosome 8
LocusYHR100C
Gene Sequence>558 bp ATGAACATCAGTGGCACCTTAAATACGCTCCGGTTGCTTTATAACCCATCACTGTGTAAG CCTAGTCTAGTTGTCCCCACTTTTAACGATCTTCCTATACCAATCCACGATTCTATAAAG GCCGTGGTCTTGGATAAGGACAACTGCATCGCCTTCCCTCATGATGACAAAATATGGCCA GATTACTTGCAACACTGGGAAACCTTAAGGTCGAAATACTCTAACAAAGCACTCTTGATT GTTAGCAATACCGCCGGTTCCAATTCTGATAAGGACTATTCGCAAGCAAAACTTTTGGAA GATAAGACAGGTATACCTGTTTTGCGGCACTCTACAAAGAAACCAGGTTGTCACAACGAA ATATTAGATTATTTTTATAGAAACAAAACCATAACAAATCCAAAAGAGGTTGCTGTTGTT GGAGATAGGCTTTTTACTGACATCTTGATGGCAAACCTAATGGGTTCATACGGGGTGTGG ATTCGAGATGGTGTTAAAGTTTCGGCAAATCCTCTCTCCAAGTTCGAAAAAAAATTATAC AACTTTTTGGGATTTTGA
Protein Properties
Pfam Domain Function
Protein Residues185
Protein Molecular Weight20944.90039
Protein Theoretical pI9.04
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Phosphatidylglycerophosphatase GEP4, mitochondrial MNISGTLNTLRLLYNPSLCKPSLVVPTFNDLPIPIHDSIKAVVLDKDNCIAFPHDDKIWP DYLQHWETLRSKYSNKALLIVSNTAGSNSDKDYSQAKLLEDKTGIPVLRHSTKKPGCHNE ILDYFYRNKTITNPKEVAVVGDRLFTDILMANLMGSYGVWIRDGVKVSANPLSKFEKKLY NFLGF
References
External Links
ResourceLink
Saccharomyces Genome Database GEP4
Uniprot IDP38812
Uniprot NameGEP4_YEAST
GenBank Gene IDAY692650
Genebank Protein ID51012751
General Reference
  • Johnston, M., Andrews, S., Brinkman, R., Cooper, J., Ding, H., Dover, J., Du, Z., Favello, A., Fulton, L., Gattung, S., et, a. l. .. (1994). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome VIII." Science 265:2077-2082.8091229
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Reinders, J., Zahedi, R. P., Pfanner, N., Meisinger, C., Sickmann, A. (2006). "Toward the complete yeast mitochondrial proteome: multidimensional separation techniques for mitochondrial proteomics." J Proteome Res 5:1543-1554.16823961
  • Osman, C., Haag, M., Potting, C., Rodenfels, J., Dip, P. V., Wieland, F. T., Brugger, B., Westermann, B., Langer, T. (2009). "The genetic interactome of prohibitins: coordinated control of cardiolipin and phosphatidylethanolamine by conserved regulators in mitochondria." J Cell Biol 184:583-596.19221197
  • Osman, C., Haag, M., Wieland, F. T., Brugger, B., Langer, T. (2010). "A mitochondrial phosphatase required for cardiolipin biosynthesis: the PGP phosphatase Gep4." EMBO J 29:1976-1987.20485265