You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NametRNA (guanine-N(1)-)-methyltransferase
Synonyms
  • M1G-methyltransferase
  • tRNA [GM37] methyltransferase
  • tRNA methyltransferase 5
Gene NameTRM5
Enzyme Class
Biological Properties
General FunctionInvolved in identical protein binding
Specific FunctionSpecifically methylates guanosine-37 in various tRNAs. Not dependent on the nature of the nucleoside 5' of the target nucleoside
Cellular LocationCytoplasm (Probable)
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00198S-AdenosylhomocysteineShow
YMDB00297S-AdenosylmethionineShow
YMDB00438S-Adenosyl-L-methionineShow
GO ClassificationNot Available
Gene Properties
Chromosome Locationchromosome 8
LocusYHR070W
Gene Sequence>1500 bp ATGAAAATCGCACTGCCAGTATTCCAAAAATTTAATAGATTGATCAGTTCGTGCAAGATG TCAGGAGTGTTCCCATACAACCCACCCGTGAATCGCCAAATGCGAGAATTGGATAGGTCA TTTTTCATCACCAAGATACCAATGTGTGCAGTCAAGTTCCCCGAACCCAAAAATATCAGT GTGTTTTCTAAAAACTTCAAAAATTGCATCTTGAGGGTGCCCCGTATCCCGCACGTTGTT AAGTTAAACTCATCCAAGCCAAAGGACGAACTGACAAGTGTACAGAACAAGAAACTAAAG ACTGCAGATGGCAATAATACCCCAGTCACGAAAGGTGTGCTGCTACACGAATCCATCCAC AGCGTGGAGGATGCGTATGGAAAATTGCCTGAGGACGCCTTGGCGTTTCTTAAGGAAAAC AGTGCGGAAATTGTACCACACGAATACGTGCTCGATTATGATTTCTGGAAAGCTGAGGAG ATTCTTCGAGCCGTGCTGCCCGAGCAATTCCTGGAAGAGGTTCCAACGGGTTTTACAATC ACAGGCCACATTGCCCACTTGAACTTGCGCACCGAGTTCAAACCATTCGACTCGCTCATC GGACAAGTCATCCTTGACAAGAACAACAAAATCGAATGTGTCGTGGACAAAGTCAGCTCC ATTGCCACACAGTTCAGGACTTTTCCTATGAAAGTCATTGCTGGGAAAAGCGATAGTCTA GTGGTAGAGCAGAAGGAATCCAACTGCACTTTCAAATTCGACTTTAGCAAGGTGTACTGG AACTCCCGATTGCACACAGAGCATGAAAGACTCGTCAAACAGTACTTCCAGCCTGGCCAA GTAGTCTGTGATGTTTTCGCCGGCGTGGGGCCCTTTGCTGTACCTGCGGGCAAGAAGGAT GTCATCGTTTTGGCTAACGACTTGAATCCTGAGAGTTACAAATACTTGAAGGAGAACATC GCATTGAACAAAGTGGCCAAGACCGTCAAATCCTTCAACATGGATGGCGCTGACTTCATC CGCCAGTCGCCACAGTTATTACAACAGTGGATTCAAGATGAAGAGGGCGGCAAGATCACG ATCCCTCTGCCTTTGAAGAAACGACACAGATCCCAGCAACACAATGACCAACAACCGCCA CAACCACGCACCAAAGAGCTGATCATTCCGTCACATATTAGCCACTATGTCATGAATCTA CCAGACAGCGCCATTTCTTTCTTAGGAAACTTCCGTGGCATCTTTGCAGCACACACTAAA GGCGCCACTGATACCATCCAAATGCCATGGGTGCACGTGCACTGTTTTGAGAAGTACCCG CCTGGCGACCAAGTCACTGAGGACGAGTTGCATGCACGCGTTCATGCCCGTATTATTGCC GCGCTCAAGGTCACTGCAGACGATCTTCCGTTGAATGCCGTTTCGTTGCATTTGGTGCGC AAAGTTGCACCCACCAAACCGATGTATTGCGCGAGTTTCCAACTTCCAGCTAACGTATGA
Protein Properties
Pfam Domain Function
Protein Residues499
Protein Molecular Weight56514.0
Protein Theoretical pI9.23
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>tRNA (guanine-N(1)-)-methyltransferase MKIALPVFQKFNRLISSCKMSGVFPYNPPVNRQMRELDRSFFITKIPMCAVKFPEPKNIS VFSKNFKNCILRVPRIPHVVKLNSSKPKDELTSVQNKKLKTADGNNTPVTKGVLLHESIH SVEDAYGKLPEDALAFLKENSAEIVPHEYVLDYDFWKAEEILRAVLPEQFLEEVPTGFTI TGHIAHLNLRTEFKPFDSLIGQVILDKNNKIECVVDKVSSIATQFRTFPMKVIAGKSDSL VVEQKESNCTFKFDFSKVYWNSRLHTEHERLVKQYFQPGQVVCDVFAGVGPFAVPAGKKD VIVLANDLNPESYKYLKENIALNKVAKTVKSFNMDGADFIRQSPQLLQQWIQDEEGGKIT IPLPLKKRHRSQQHNDQQPPQPRTKELIIPSHISHYVMNLPDSAISFLGNFRGIFAAHTK GATDTIQMPWVHVHCFEKYPPGDQVTEDELHARVHARIIAALKVTADDLPLNAVSLHLVR KVAPTKPMYCASFQLPANV
References
External Links
ResourceLink
Saccharomyces Genome Database TRM5
Uniprot IDP38793
Uniprot NameTRM5_YEAST
GenBank Gene IDU00061
Genebank Protein ID487945
General Reference
  • Johnston, M., Andrews, S., Brinkman, R., Cooper, J., Ding, H., Dover, J., Du, Z., Favello, A., Fulton, L., Gattung, S., et, a. l. .. (1994). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome VIII." Science 265:2077-2082.8091229
  • Bjork, G. R., Jacobsson, K., Nilsson, K., Johansson, M. J., Bystrom, A. S., Persson, O. P. (2001). "A primordial tRNA modification required for the evolution of life?" EMBO J 20:231-239.11226173
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106