You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameDeoxyhypusine synthase
Synonyms
  • DHS
Gene NameDYS1
Enzyme Class
Biological Properties
General FunctionInvolved in peptidyl-lysine modification to hypusine
Specific FunctionCatalyzes the NAD-dependent oxidative cleavage of spermidine and the subsequent transfer of the butylamine moiety of spermidine to the epsilon-amino group of a specific lysine residue of the eIF-5A precursor protein to form the intermediate deoxyhypusine residue
Cellular LocationNot Available
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG Reactions
Spermidine + Ubiquinone-6 + water1,3-Diaminopropane + Ubiquinol-6 + 4-aminobutanal
Metabolites
YMDB IDNameView
YMDB000421,3-DiaminopropaneShow
YMDB00232SpermidineShow
YMDB005874-aminobutanalShow
YMDB00660Ubiquinone-6Show
YMDB00890waterShow
YMDB00915Ubiquinol-6Show
GO Classification
Component
Not Available
Function
Not Available
Process
macromolecule metabolic process
macromolecule modification
protein modification process
peptidyl-amino acid modification
peptidyl-lysine modification
peptidyl-lysine modification to hypusine
metabolic process
Gene Properties
Chromosome Locationchromosome 8
LocusYHR068W
Gene Sequence>1164 bp ATGTCCGATATCAACGAAAAACTCCCAGAGTTACTACAAGACGCTGTCTTGAAAGCATCT GTTCCTATTCCAGATGACTTCGTTAAGGTTCAAGGTATTGATTACTCAAAGCCTGAAGCC ACTAATATGAGAGCAACTGATTTAATTGAAGCTATGAAGACCATGGGTTTCCAAGCTAGT TCTGTTGGTACTGCCTGTGAGATTATTGATAGTATGAGATCATGGAGAGGTAAGCATATT GACGAATTGGATGACCATGAAAAGAAAGGTTGCTTCGATGAGGAAGGGTACCAAAAGACT ACTATCTTCATGGGTTATACTTCTAACTTGATCAGTTCCGGTGTACGTGAAACTTTACGT TATTTGGTGCAACACAAAATGGTTGATGCTGTCGTTACTTCTGCTGGTGGTGTGGAAGAA GATTTGATCAAATGTCTTGCTCCAACTTACTTGGGTGAATTTGCTTTGAAAGGTAAATCT TTGCGTGACCAAGGTATGAATCGTATTGGTAACTTGCTTGTTCCAAATGATAACTACTGT AAGTTTGAAGAATGGATTGTCCCAATTTTGGATAAGATGTTGGAAGAACAAGATGAATAC GTAAAGAAACATGGCGCTGACTGTTTAGAGGCTAACCAAGACGTGGATTCACCAATCTGG ACCCCATCTAAGATGATAGACCGTTTTGGTAAGGAAATCAACGACGAATCCTCCGTATTG TACTGGGCCCACAAGAATAAAATTCCAATCTTTTGTCCATCTTTGACTGATGGTTCAATC GGTGACATGTTGTTTTTCCATACTTTTAAAGCATCTCCAAAACAACTAAGAGTTGACATT GTAGGAGATATCCGCAAAATCAATTCAATGTCCATGGCCGCTTACAGAGCCGGTATGATC ATCTTGGGTGGTGGTTTGATCAAGCACCACATTGCCAATGCTTGTTTGATGAGAAATGGT GCTGATTATGCCGTTTACATTAACACTGGTCAAGAATACGATGGTTCTGATGCAGGTGCA AGACCTGACGAAGCTGTGTCTTGGGGTAAGATCAAGGCTGAAGCCAAATCCGTCAAACTT TTTGCTGATGTCACCACTGTTCTTCCATTGATTGTTGCTGCTACCTTTGCCAGTGGTAAA CCAATCAAAAAAGTTAAGAATTGA
Protein Properties
Pfam Domain Function
Protein Residues387
Protein Molecular Weight42891.80078
Protein Theoretical pI5.49
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Deoxyhypusine synthase MSDINEKLPELLQDAVLKASVPIPDDFVKVQGIDYSKPEATNMRATDLIEAMKTMGFQAS SVGTACEIIDSMRSWRGKHIDELDDHEKKGCFDEEGYQKTTIFMGYTSNLISSGVRETLR YLVQHKMVDAVVTSAGGVEEDLIKCLAPTYLGEFALKGKSLRDQGMNRIGNLLVPNDNYC KFEEWIVPILDKMLEEQDEYVKKHGADCLEANQDVDSPIWTPSKMIDRFGKEINDESSVL YWAHKNKIPIFCPSLTDGSIGDMLFFHTFKASPKQLRVDIVGDIRKINSMSMAAYRAGMI ILGGGLIKHHIANACLMRNGADYAVYINTGQEYDGSDAGARPDEAVSWGKIKAEAKSVKL FADVTTVLPLIVAATFASGKPIKKVKN
References
External Links
ResourceLink
Saccharomyces Genome Database DYS1
Uniprot IDP38791
Uniprot NameDHYS_YEAST
GenBank Gene IDAY558282
Genebank Protein ID45270454
General Reference
  • Sasaki, K., Abid, M. R., Miyazaki, M. (1996). "Deoxyhypusine synthase gene is essential for cell viability in the yeast Saccharomyces cerevisiae." FEBS Lett 384:151-154.8612813
  • Johnston, M., Andrews, S., Brinkman, R., Cooper, J., Ding, H., Dover, J., Du, Z., Favello, A., Fulton, L., Gattung, S., et, a. l. .. (1994). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome VIII." Science 265:2077-2082.8091229
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Kang, K. R., Wolff, E. C., Park, M. H., Folk, J. E., Chung, S. I. (1995). "Identification of YHR068w in Saccharomyces cerevisiae chromosome VIII as a gene for deoxyhypusine synthase. Expression and characterization of the enzyme." J Biol Chem 270:18408-18412.7629166
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106