You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
Name2-dehydropantoate 2-reductase
Synonyms
  • Ketopantoate reductase
  • KPA reductase
  • KPR
Gene NamePAN5
Enzyme Class
Biological Properties
General FunctionInvolved in oxidoreductase activity
Specific FunctionCatalyzes the NADPH-dependent reduction of ketopantoate into pantoic acid
Cellular LocationNot Available
SMPDB Pathways
Pantothenate and CoA biosynthesisPW002463 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Pantothenate and CoA biosynthesisec00770 Map00770
SMPDB Reactions
2-Dehydropantoate + NADPH + hydronNADP + (R)-Pantoate
(S)-2-Acetolactate + hydron + NADPHNADP + (R)-2,3-Dihydroxy-isovalerate
(S)-2-Aceto-2-hydroxybutanoic acid + NADPH + hydronNADP + (R)-2,3-Dihydroxy-3-methylvalerate
KEGG Reactions
2-Dehydropantoic acid + NADPH + hydronNADP + (R)-Pantoic acid
Metabolites
YMDB IDNameView
YMDB00039(S)-2-Aceto-2-hydroxybutanoic acidShow
YMDB00063(R)-2,3-Dihydroxy-isovalerateShow
YMDB00068(R)-2,3-Dihydroxy-3-methylvalerateShow
YMDB000932-Dehydropantoic acidShow
YMDB00177(S)-2-AcetolactateShow
YMDB00376(R)-Pantoic acidShow
YMDB00426NADPHShow
YMDB00427NADPShow
YMDB00862hydronShow
YMDB01012(R)-PantoateShow
YMDB010582-DehydropantoateShow
GO Classification
Component
intracellular part
cytoplasm
cell part
Function
nucleotide binding
oxidoreductase activity
catalytic activity
cofactor binding
NADP or NADPH binding
binding
coenzyme binding
Process
pantothenate biosynthetic process
oxidation reduction
cofactor metabolic process
coenzyme metabolic process
metabolic process
coenzyme biosynthetic process
cellular metabolic process
Gene Properties
Chromosome Locationchromosome 8
LocusYHR063C
Gene Sequence>YHR063C PAN5 SGDID:S000001105, Chr VIII from 225169-224030, reverse complement, Verified ORF, "2-dehydropantoate 2-reductase, part of the pantothenic acid pathway, structurally homologous to E. coli panE" ATGACTGCACCACACAGAAGTACTATTCATATTCTTGGGTTGGGTGCCATGGGTACCGTT TTGGCAGTTGACCTTTTAAGATTTACCAATGCCCTAGTTGTGCCCTTATTTAGATCACAA GAAAGACTTGCACAATTTCAGAAGACAAATGGGAACAACATTTCGATTCGCAAACTTTAT TTGGAAGGCTCGCCAATATTTTCTTATCCAGTGGAGAAATGCGAATGCCCTGAAACTTTC TCTAAAAAACCTATTGACAACTTAGTCGTCACTACAAAGACTTACCAAACCAAAGAAGCA CTAGCTCCTTATTTGCCTTATATTAATAAAAATACAAACTTAATTTTGATTCAGAATGGA CTGGGCGTTTTAGAACTATTGAGAGAAGAAATCTTTACAGATTCAAAAAACAGACCACAT TTATTTCAGGGTGTCATTTCTCATGGCGTTTATCAGGATAAAGCAGGAGTTTTCAATCAT GCTGGGTGGGCTGGTATGAAAATTGCCAAATTGCCTTGGACTGAGGAAGAAATGATTCAA AAAAAATCCGTAGTCGAGGACGATGCAGCCAATAACTCATTAGTAAAATTATTAACAGAA CCAAAATTTGCCAAGGAATTTGGAATAGAACATTCCACTTATCAAGAAATGCTCTTTGGT CAATTATTTAAATTTTTGGTTAATGCATGCATGAATCCAGTTACGGCTATTCTAGATTGT GTCAATGGTGAGATGAAGGCCAGTTGCGGTCCAGTTTTCACATCTATTATTGACGAGTGT TTACAAATATTGAGAGTTGCTTATAGGCCATTGTTTCAATACCACGAAAAATACAGCGGT AATGAAGAATACCCAGAAATGGATGTCAATGCAGTACTGACAACCGATAACATGGTCTCC GAAGTCACTAGAATTGGCTGTGACATCAATTCTAGGAACAGTAGTTCAATGAGACAAGAC ACTTTGTTCTTAAGAGACATTGAAATTGAGTATATCAATGGCTATGTCGTCAAATTGGCT GATAACTTAAATCTAGACCCAAACTGCTGCAAGGTTAATAAAACTATCGGAGAATTGGCC ACTATGAGATTAGCATTGAACAGGTCGAGAAGTATCAATGGTGACTGGAGAAAGGACTGA
Protein Properties
Pfam Domain Function
Protein Residues379
Protein Molecular Weight42820.89844
Protein Theoretical pI6.62
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>2-dehydropantoate 2-reductase MTAPHRSTIHILGLGAMGTVLAVDLLRFTNALVVPLFRSQERLAQFQKTNGNNISIRKLY LEGSPIFSYPVEKCECPETFSKKPIDNLVVTTKTYQTKEALAPYLPYINKNTNLILIQNG LGVLELLREEIFTDSKNRPHLFQGVISHGVYQDKAGVFNHAGWAGMKIAKLPWTEEEMIQ KKSVVEDDAANNSLVKLLTEPKFAKEFGIEHSTYQEMLFGQLFKFLVNACMNPVTAILDC VNGEMKASCGPVFTSIIDECLQILRVAYRPLFQYHEKYSGNEEYPEMDVNAVLTTDNMVS EVTRIGCDINSRNSSSMRQDTLFLRDIEIEYINGYVVKLADNLNLDPNCCKVNKTIGELA TMRLALNRSRSINGDWRKD
References
External Links
ResourceLink
Saccharomyces Genome Database PAN5
Uniprot IDP38787
Uniprot NamePANE_YEAST
General Reference
  • Johnston, M., Andrews, S., Brinkman, R., Cooper, J., Ding, H., Dover, J., Du, Z., Favello, A., Fulton, L., Gattung, S., et, a. l. .. (1994). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome VIII." Science 265:2077-2082.8091229
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106