You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
Name2-deoxyglucose-6-phosphate phosphatase 2
Synonyms
  • 2-DOG-6-P 2
  • 2-deoxyglucose-6-phosphatase 2
Gene NameDOG2
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionActive on 2-DOG-6P, not very active on fructose-1p
Cellular LocationCytoplasmic
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB002942-deoxy-D-glucoseShow
YMDB008402-deoxy-D-glucose 6-phosphateShow
YMDB00890waterShow
YMDB00907phosphateShow
GO Classification
Component
Not Available
Function
hydrolase activity
catalytic activity
Process
metabolic process
Gene Properties
Chromosome Locationchromosome 8
LocusYHR043C
Gene Sequence>741 bp ATGCCACAATTTTCAGTAGATCTTTGTCTTTTTGACCTAGATGGGACTATTGTCAGCACA ACAACTGCAGCGGAAAGTGCCTGGAAAAAATTATGCCGTCAGCATGGGGTTGATCCTGTT GAGTTATTCAAGCATTCCCATGGTGCAAGATCACAAGAAATGATGAAGAAATTTTTTCCA AAATTGGACAATACCGATAATAAAGGTGTTCTTGCGTTAGAAAAGGATATGGCAGATAAT TATTTGGACACAGTAAGCCTTATCCCTGGTGCAGAGAATTTATTGTTATCGTTAGATGTA GATACTGAGACTCAAAAAAAGTTACCTGAAAGGAAATGGGCTATCGTTACCTCTGGTTCT CCATATTTGGCATTTTCATGGTTCGAGACAATATTGAAAAATGTTGGAAAGCCCAAAGTT TTCATTACTGGATTTGACGTGAAGAACGGTAAGCCTGATCCCGAGGGTTACTCAAGAGCT CGTGATTTATTGCGTCAAGATTTGCAATTAACTGGTAAACAGGATCTGAAGTATGTTGTC TTTGAAGATGCACCCGTGGGCATAAAGGCCGGCAAAGCAATGGGCGCAATTACTGTGGGT ATAACATCCTCGTATGATAAGAGCGTTTTATTTGACGCAGGTGCAGATTATGTGGTCTGT GATTTGACACAGGTTTCCGTGGTTAAGAACAATGAGAACGGTATCGTTATCCAGGTAAAC AACCCTTTGACGAGAGATTAA
Protein Properties
Pfam Domain Function
Protein Residues246
Protein Molecular Weight27164.80078
Protein Theoretical pI5.4
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>2-deoxyglucose-6-phosphate phosphatase 2 MPQFSVDLCLFDLDGTIVSTTTAAESAWKKLCRQHGVDPVELFKHSHGARSQEMMKKFFP KLDNTDNKGVLALEKDMADNYLDTVSLIPGAENLLLSLDVDTETQKKLPERKWAIVTSGS PYLAFSWFETILKNVGKPKVFITGFDVKNGKPDPEGYSRARDLLRQDLQLTGKQDLKYVV FEDAPVGIKAGKAMGAITVGITSSYDKSVLFDAGADYVVCDLTQVSVVKNNENGIVIQVN NPLTRD
References
External Links
ResourceLink
Saccharomyces Genome Database DOG2
Uniprot IDP38773
Uniprot NameDOG2_YEAST
GenBank Gene IDU00062
Genebank Protein ID488181
General Reference
  • Randez-Gil, F., Blasco, A., Prieto, J. A., Sanz, P. (1995). "DOGR1 and DOGR2: two genes from Saccharomyces cerevisiae that confer 2-deoxyglucose resistance when overexpressed." Yeast 11:1233-1240.8553694
  • Johnston, M., Andrews, S., Brinkman, R., Cooper, J., Ding, H., Dover, J., Du, Z., Favello, A., Fulton, L., Gattung, S., et, a. l. .. (1994). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome VIII." Science 265:2077-2082.8091229
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106