You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameLow-affinity methionine permease
SynonymsNot Available
Gene NameMUP3
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in transport
Specific FunctionVery low affinity permease for methionine
Cellular LocationMembrane; Multi-pass membrane protein (Potential)
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00318L-MethionineShow
YMDB00862hydronShow
GO Classification
Component
cell part
membrane
Function
transporter activity
transmembrane transporter activity
active transmembrane transporter activity
amine transmembrane transporter activity
amino acid transmembrane transporter activity
Process
transmembrane transport
establishment of localization
transport
amine transport
amino acid transport
Gene Properties
Chromosome Locationchromosome 8
LocusYHL036W
Gene Sequence>1641 bp ATGGAACCGCTGCTTTTTAATAGTGGGAAAGCAAATCCCTCTCAAGATGTTTTCATAGAT GTGGAAGTTGGTGATATTACCACAAAATATGGTTCCACAAATACTGGATCATTCAGTTCG ATGGATACTGTGGAAGCGCAGGCGATAAAGGCAGAGACGGCAAGATTCATGGAAGTTCCA CAGGGAAGACATTTAGGTGTGTTCTCCACGGTTGTGTTATTTGTTTCGAGGATAATGGGG TCAGGTATATTTGCAGTACCCAGTGTGATTTTACTGAATACAGGTGGTAATAAGCTGATA TATTTTGCGATCTGGGTTTTTAGCGCTGCGATCGCTTTTGCAGGATTGTATCTTTTTCTA GAATTTGGTTCCTGGATACCGAAATCAGGTGGACGTAAAAACTTCCTCGAACGGAGTTTT GAAAGACCCAGACTATTAATTAGTGTGGTGTTTTCGTGTTACAGTGTTTTAACTGGCTAT GCATTGACGGGATCTATCGTCTTCGGTAAATACGTGTTGAGCGCATTTGGAGTCACGGAT GATTCGTGGTCCAAGTACGTCAGCATATCATTTATAATATTTGCCGTTCTCATTCACGGT GTCTCTGTAAGGCACGGAGTGTTTATACAGAACGCACTTGGTGGTTTGAAGTTGATCATG ATTGTCTTGATGTGCTTTGCCGGGCTATACACGCTTTTCTTTTATAAAAGCACCGGTCAA GTTGCCTGGGACCTCCCAGTAACCCAAGTTGAGAAAGATTCTCTCCTGTCGGTGTCCTCT ATTGCTACTGCCTTTATCAGCTCATTCTTTTGTTTTTCTGGATGGGATACAGTTCACACA GTTACATCAGAAATTAAGAATCCCGTTAAGACGTTGAAGGTGTCAGGTCCCTTATCGTTG ATAATTTGTTTTGTCTGCTACACAATGATGAATGTGGCATACTTGAAAGTTTTGACATAT GAGGAAATTGTTAGTGCAGGCCCCCTGGTTGGTTCCGTGTTGTTTACCAAACTTTTCGGA CCCAGAGTTGGTGGCAAATTCATTGCTTTTTCTATCGCCATTTCTGCAGCATCTAATATT CTGGTTGTCATTTACAGTATATCAAGAGTTAACCAGGAAATATTCAAAGAAGGTTATTTA CCATTCAGTATTCATATGTCCAAAAATTGGCCATTTGATGCACCTCTACCATCTATTTCT TTATGTGGCTTTATAACCATTGCTTGGATATTGATTTTACCCAAAGAGGGCGAATCCTTC AATTATCTGGTATCGATGGATGGTTATGGTAATCAGTTTTTCTTATTATTGGTCGCTATT GGGCTCTTTATTTGGAGGTTCAAACACAAGAACGAAGTCCCAGAGATTCGTGCATCTACT TTTGGAGTATTAGCCATTATTACATTATCATTATACATGTTGATGGCACCATTCTTTGCC GACCCTAGCCTAAACAGAGTTGGGTTCCTGCCGCCCTACCAAATCATGTCATTACTGGTA ATAGTTGCATGCTTCTTTTTCTGGTTAGTTAAATTCGTTTTACTACCTAAATTCTTCCAT TATAAACTTTTACCCAAAATCACTTATTTGCATGATGGGCTCATTGTCACAGAATGGGTG AAAAAGCCATGTCTGTGTTAG
Protein Properties
Pfam Domain Function
Protein Residues546
Protein Molecular Weight60619.10156
Protein Theoretical pI8.95
Signalling Regions
  • None
Transmembrane Regions
  • 71-91
  • 99-119
  • 149-169
  • 189-209
  • 214-234
  • 255-275
  • 298-318
  • 320-340
  • 347-367
  • 394-414
  • 424-444
  • 460-480
  • 495-515
Protein Sequence>Low-affinity methionine permease MEPLLFNSGKANPSQDVFIDVEVGDITTKYGSTNTGSFSSMDTVEAQAIKAETARFMEVP QGRHLGVFSTVVLFVSRIMGSGIFAVPSVILLNTGGNKLIYFAIWVFSAAIAFAGLYLFL EFGSWIPKSGGRKNFLERSFERPRLLISVVFSCYSVLTGYALTGSIVFGKYVLSAFGVTD DSWSKYVSISFIIFAVLIHGVSVRHGVFIQNALGGLKLIMIVLMCFAGLYTLFFYKSTGQ VAWDLPVTQVEKDSLLSVSSIATAFISSFFCFSGWDTVHTVTSEIKNPVKTLKVSGPLSL IICFVCYTMMNVAYLKVLTYEEIVSAGPLVGSVLFTKLFGPRVGGKFIAFSIAISAASNI LVVIYSISRVNQEIFKEGYLPFSIHMSKNWPFDAPLPSISLCGFITIAWILILPKEGESF NYLVSMDGYGNQFFLLLVAIGLFIWRFKHKNEVPEIRASTFGVLAIITLSLYMLMAPFFA DPSLNRVGFLPPYQIMSLLVIVACFFFWLVKFVLLPKFFHYKLLPKITYLHDGLIVTEWV KKPCLC
References
External Links
ResourceLink
Saccharomyces Genome Database MUP3
Uniprot IDP38734
Uniprot NameMUP3_YEAST
GenBank Gene IDU11583
Genebank Protein ID2289865
General Reference
  • Johnston, M., Andrews, S., Brinkman, R., Cooper, J., Ding, H., Dover, J., Du, Z., Favello, A., Fulton, L., Gattung, S., et, a. l. .. (1994). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome VIII." Science 265:2077-2082.8091229
  • Isnard, A. D., Thomas, D., Surdin-Kerjan, Y. (1996). "The study of methionine uptake in Saccharomyces cerevisiae reveals a new family of amino acid permeases." J Mol Biol 262:473-484.8893857
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258