Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameArginyl-tRNA synthetase, mitochondrial
Synonyms
  • Arginine--tRNA ligase
  • ArgRS
Gene NameMSR1
Enzyme Class
Biological Properties
General FunctionInvolved in nucleotide binding
Specific FunctionATP + L-arginine + tRNA(Arg) = AMP + diphosphate + L-arginyl-tRNA(Arg)
Cellular LocationMitochondrion matrix
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG Reactions
L-Arginine + Adenosine triphosphate + tRNA(Arg) → Adenosine monophosphate + Pyrophosphate + Arg-tRNA(Arg)
Metabolites
YMDB IDNameView
YMDB00097Adenosine monophosphateShow
YMDB00109Adenosine triphosphateShow
YMDB00219PyrophosphateShow
YMDB00592L-ArginineShow
GO Classification
Component
cell part
intracellular part
cytoplasm
Function
ligase activity, forming carbon-oxygen bonds
ligase activity, forming aminoacyl-tRNA and related compounds
aminoacyl-tRNA ligase activity
catalytic activity
nucleotide binding
ligase activity
binding
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
arginine-tRNA ligase activity
adenyl ribonucleotide binding
ATP binding
Process
metabolic process
cellular macromolecule metabolic process
macromolecule metabolic process
RNA metabolic process
ncRNA metabolic process
tRNA metabolic process
biosynthetic process
tRNA aminoacylation
tRNA aminoacylation for protein translation
macromolecule biosynthetic process
cellular macromolecule biosynthetic process
translation
arginyl-tRNA aminoacylation
Gene Properties
Chromosome Locationchromosome 8
LocusYHR091C
Gene Sequence>1932 bp ATGTTCGGGATAGTTTATCTGAAGAATCGCAGTTTACTCTGCAAGAACCCCTTTTCTTCT TACCCTCGTTATGGCTTCATGCCCTCGTTCGACACCCAGTTCAGCAACCAATTTCGTAAA TTAGAAATTAATATTGGACGGAAAAGATACAGCTCAAAAACCTTGAATACAAAATATACT GACCAACCCGAAGGCCCAATTTATCCTTTGGATGTACTACGCCTAGACATCTCAAAAGCA CTGCATGATATATCCGGAATAGACCACTCGCTAATACTAAATGCGCTTGAGTCGACAAAT AGTATGGATAGAGGTGATCTACTGCTACCTCTTCCAAAGATAAAAGTGGCTGACCCTGTG GCCGTTGCCAACCGATGGGCCATTGAACTAAGCACGCATGGGTGTATTGGAAAGGTTTGT GCAAAAGGGCCATTTCTTCAGTTCTTCCTGGACCAGCGGTATTTGATACAATCAACGGTA CCAAATATATTACTTCAAAAGGGGAAATATGGTCAGAAAAAATCTCGTCATCAGAAAAAA GTTGTAGTAGAATTTTCATCACCAAATATTGCCAAACCATTCCATGCAGGCCATTTAAGA TCGACTATAATAGGTGGATTCCTTTCAAACTTATATGAAGCAATGGGGTGGTCCGTTACA CGTATGAACTACCTAGGAGACTGGGGCAGACAGTTTGGTTTGTTAGCAGTCGGTTTTAAG AGATACGGCGATGAAAAGACGTTACAAAAGCAGCCAATTCAGCATTTATTCGACGTCTAC GTTAAAATCAACATGGACCTTGCCAAGGAAGAGATAAACGGAAACTCTAAGTGTGGGATT AGCGGTGAGGCCCGTAGTTTTTTCAAAAACTTAGAAAATGGGGATGAGAATGCCATTAAG ATATGGAATAGGTTTCGCTCGTTATCCATCCACCACTATATCCAAACTTATTCACGTTTG AACATTAATTTTGATATATTCTCCGGTGAATCACAAGTGTCTAAAGAATCTATGAATGAA GCCTTAGATATATTTCGCAAAAACAATCTTGTTAAAGAAATAGACGGTGCCCTTGTCATC GATTTAACCCAATGGTCGAAAAGATTGGGCAGAGTTGTTGTACAAAAATCAGACGGAACA ACTTTGTACTTGACAAGAGATGTAGGGGCAGCCATAGAGCGTAAAAAGAATCTACATTTT GATAAAATGGTGTACGTGATTTCCTCACAGCAAGATTTATACATGTCCCAGTTTTTTATG ATATTAAAAAAAATGAATTTTGAATGGGCAAAAGACTTGCAGCATATAAATTTTGGTATG GTGCAGGGCATGTCGACCAGAAAAGGAAATGTGGTATTCTTAGATACCATACTAGACGAG GCAAGGGATAAAGCTCTGCAAATTATGGAAAATAACAAAATGAAAATATCTCAGGTAGAT AATCCACAGCGTGTTGCAGATTTAATTGGCGTATCTGCTATCATTATTCAAGATACGAAA TCAAAGCGTATCAATAACTATGAATTCAACTGGAACAGAATGTTGTCTTTCGAAGGTGAC ACAGGGCCCTATTTACAATACACACATTCCAGACTTAGATCTTTAGAAAGGACCTCCAGC GACTTTACGACGGACATGCTAATACACGCAGATTTTTCAAATTTAAATGAACCACAACTA GTTGAGCTTGTGAGGTTGCTAGCGCAGTATCCAGATGTCCTTAGACGAGCATTCGAAACT CAAGAGCCGGCCACGATTGTAACATATTTATTCAAAGTTTGCCATCAGGTCTCCTCGTGC TATAAAAAAATATGGGTTTCCGGAAAACCTGCAGATATTGCCATACCGCGACTCGCCGTA TATTCAGCAAGTAGACAAGTGTTACACAATGCAATGTCGCTTTTGGGACTAGTCCCGGTT GATAGAATGTAA
Protein Properties
Pfam Domain Function
Protein Residues643
Protein Molecular Weight73693.39844
Protein Theoretical pI9.84
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Arginyl-tRNA synthetase, mitochondrial MFGIVYLKNRSLLCKNPFSSYPRYGFMPSFDTQFSNQFRKLEINIGRKRYSSKTLNTKYT DQPEGPIYPLDVLRLDISKALHDISGIDHSLILNALESTNSMDRGDLLLPLPKIKVADPV AVANRWAIELSTHGCIGKVCAKGPFLQFFLDQRYLIQSTVPNILLQKGKYGQKKSRHQKK VVVEFSSPNIAKPFHAGHLRSTIIGGFLSNLYEAMGWSVTRMNYLGDWGRQFGLLAVGFK RYGDEKTLQKQPIQHLFDVYVKINMDLAKEEINGNSKCGISGEARSFFKNLENGDENAIK IWNRFRSLSIHHYIQTYSRLNINFDIFSGESQVSKESMNEALDIFRKNNLVKEIDGALVI DLTQWSKRLGRVVVQKSDGTTLYLTRDVGAAIERKKNLHFDKMVYVISSQQDLYMSQFFM ILKKMNFEWAKDLQHINFGMVQGMSTRKGNVVFLDTILDEARDKALQIMENNKMKISQVD NPQRVADLIGVSAIIIQDMKSKRINNYEFNWNRMLSFEGDTGPYLQYTHSRLRSLERTSS DFTTDMLIHADFSNLNEPQLVELVRLLAQYPDVLRRAFETQEPATIVTYLFKVCHQVSSC YKKIWVSGKPADIAIPRLAVYSASRQVLHNAMSLLGLVPVDRM
References
External Links
ResourceLink
Saccharomyces Genome Database MSR1
Uniprot IDP38714
Uniprot NameSYRM_YEAST
GenBank Gene IDL39019
Genebank Protein ID633022
General Reference
  • Johnston, M., Andrews, S., Brinkman, R., Cooper, J., Ding, H., Dover, J., Du, Z., Favello, A., Fulton, L., Gattung, S., et, a. l. .. (1994). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome VIII." Science 265:2077-2082.8091229