Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameAsparaginyl-tRNA synthetase, cytoplasmic
Synonyms
  • Asparagine--tRNA ligase
  • AsnRS
Gene NameDED81
Enzyme Class
Biological Properties
General FunctionInvolved in nucleotide binding
Specific FunctionATP + L-asparagine + tRNA(Asn) = AMP + diphosphate + L-asparaginyl-tRNA(Asn)
Cellular LocationCytoplasm
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG Reactions
Adenosine triphosphate + L-Asparagine + tRNA(Asn) → Adenosine monophosphate + Pyrophosphate + Asn-tRNA(Asn)
Metabolites
YMDB IDNameView
YMDB00097Adenosine monophosphateShow
YMDB00109Adenosine triphosphateShow
YMDB00219PyrophosphateShow
YMDB00226L-AsparagineShow
GO Classification
Component
intracellular part
cytoplasm
cell part
Function
ligase activity
binding
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
nucleic acid binding
adenyl ribonucleotide binding
aspartate-tRNA ligase activity
ATP binding
asparagine-tRNA ligase activity
ligase activity, forming carbon-oxygen bonds
ligase activity, forming aminoacyl-tRNA and related compounds
aminoacyl-tRNA ligase activity
catalytic activity
nucleotide binding
Process
ncRNA metabolic process
tRNA metabolic process
biosynthetic process
tRNA aminoacylation
tRNA aminoacylation for protein translation
macromolecule biosynthetic process
cellular macromolecule biosynthetic process
translation
aspartyl-tRNA aminoacylation
asparaginyl-tRNA aminoacylation
metabolic process
cellular macromolecule metabolic process
macromolecule metabolic process
RNA metabolic process
Gene Properties
Chromosome Locationchromosome 8
LocusYHR019C
Gene Sequence>1665 bp ATGTCATCTTTGTACATTAAGGAGGCTACCGGTGTAGACGAATTGACCACAGCCGGTTCA CAAGACCATCCATTCAAAACCCCAGCATATGCTTTGTTCGCATCTCAACAGAAGAGCGAT GCCACGGAACCTAAGCTTTTCGTGTTTAAGACAGAAGACAACGAGTACCAGGAAATCAGT GCTTCTGCTTTGAAGAAGGCTCGTAAGGGCTGTGATGGTTTGAAGAAAAAGGCAGTCAAG CAAAAGGAACAGGAGTTGAAGAAACAACAAAAAGAGGCAGAAAATGCTGCCAAGCAATTG TCTGCTTTGAATATCACCATTAAGGAGGACGAATCGCTACCAGCTGCCATTAAGACTAGA ATTTATGACTCTTATTCCAAGGTCGGACAAAGAGTTAAGGTTTCCGGTTGGATCCATAGA TTACGTTCTAACAAGAAGGTTATTTTCGTCGTCCTCAGAGACGGATCTGGTTTCATTCAA TGTGTCTTGTCCGGTGATTTGGCATTGGCTCAACAAACTTTGGACCTGACTTTGGAATCC ACCGTTACTCTGTACGGTACCATAGTCAAATTGCCTGAGGGTAAAACCGCTCCAGGTGGT GTTGAATTGAATGTCGACTATTACGAAGTTGTAGGTTTGGCCCCCGGTGGTGAAGACTCC TTTACAAACAAAATCGCAGAGGGCTCAGACCCTTCTTTACTGTTGGACCAACGTCATTTG GCCTTGAGAGGAGATGCCTTGTCTGCAGTCATGAAAGTCCGTGCTGCTCTACTGAAAAGC GTTAGACGTGTTTATGATGAAGAACATTTGACAGAAGTTACCCCACCATGTATGGTGCAA ACTCAAGTCGAAGGTGGTTCCACTTTGTTCAAGATGAACTATTACGGCGAGGAAGCTTAC TTGACCCAAAGTTCCCAATTATATTTAGAAACCTGTTTGGCCTCCCTAGGTGATGTTTAT ACCATCCAAGAATCTTTCAGAGCTGAAAAGTCCCACACAAGAAGACATTTGTCCGAATAT ACCCATATCGAAGCTGAATTGGCCTTCTTGACTTTCGACGATCTATTACAACATATTGAA ACTTTGATCGTCAAATCCGTGCAATACGTTTTGGAAGACCCAATTGCTGGCCCACTCGTA AAACAATTGAATCCAAACTTTAAGGCTCCAAAGGCTCCATTCATGAGATTACAGTACAAG GATGCCATTACCTGGTTGAACGAACACGACATCAAGAACGAAGAGGGCGAAGACTTTAAA TTTGGTGACGATATTGCAGAAGCTGCTGAAAGAAAGATGACCGATACCATCGGCGTCCCA ATCTTTTTGACGAGATTCCCAGTAGAAATCAAGTCTTTCTACATGAAGCGTTGTTCTGAC GACCCCCGCGTCACTGAATCCGTCGACGTTTTGATGCCAAACGTTGGTGAAATCACTGGT GGTTCTATGAGAATCGACGACATGGACGAACTAATGGCAGGGTTTAAGCGTGAGGGTATT GATACCGACGCCTACTACTGGTTCATTGACCAAAGAAAATACGGTACTTGCCCACATGGT GGTTACGGTATCGGTACCGAACGTATTTTAGCCTGGTTGTGTGACAGATTCACTGTCAGA GACTGTTCCTTGTATCCACGTTTCAGCGGTAGATGTAAGCCATGA
Protein Properties
Pfam Domain Function
Protein Residues554
Protein Molecular Weight62206.30078
Protein Theoretical pI5.59
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Asparaginyl-tRNA synthetase, cytoplasmic MSSLYIKEATGVDELTTAGSQDHPFKTPAYALFASQQKSDATEPKLFVFKTEDNEYQEIS ASALKKARKGCDGLKKKAVKQKEQELKKQQKEAENAAKQLSALNITIKEDESLPAAIKTR IYDSYSKVGQRVKVSGWIHRLRSNKKVIFVVLRDGSGFIQCVLSGDLALAQQTLDLTLES TVTLYGTIVKLPEGKTAPGGVELNVDYYEVVGLAPGGEDSFTNKIAEGSDPSLLLDQRHL ALRGDALSAVMKVRAALLKSVRRVYDEEHLTEVTPPCMVQTQVEGGSTLFKMNYYGEEAY LTQSSQLYLETCLASLGDVYTIQESFRAEKSHTRRHLSEYTHIEAELAFLTFDDLLQHIE TLIVKSVQYVLEDPIAGPLVKQLNPNFKAPKAPFMRLQYKDAITWLNEHDIKNEEGEDFK FGDDIAEAAERKMTDTIGVPIFLTRFPVEIKSFYMKRCSDDPRVTESVDVLMPNVGEITG GSMRIDDMDELMAGFKREGIDTDAYYWFIDQRKYGTCPHGGYGIGTERILAWLCDRFTVR DCSLYPRFSGRCKP
References
External Links
ResourceLink
Saccharomyces Genome Database DED81
Uniprot IDP38707
Uniprot NameSYNC_YEAST
GenBank Gene IDU10399
Genebank Protein ID500693
General Reference
  • Johnston, M., Andrews, S., Brinkman, R., Cooper, J., Ding, H., Dover, J., Du, Z., Favello, A., Fulton, L., Gattung, S., et, a. l. .. (1994). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome VIII." Science 265:2077-2082.8091229
  • Landrieu, I., Vandenbol, M., Leberman, R., Portetelle, D., Hartlein, M. (1998). "Identification of YHR019 in Saccharomyces cerevisiae chromosome VIII as the gene for the cytosolic asparaginyl-tRNA synthetase." Yeast 14:527-533.9605503
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956