You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameSeryl-tRNA synthetase, mitochondrial
Synonyms
  • Digs into agar protein 4
  • Serine--tRNA ligase
  • SerRS
  • Seryl-tRNA(Ser/Sec) synthetase
Gene NameDIA4
Enzyme Class
Biological Properties
General FunctionInvolved in nucleotide binding
Specific FunctionCatalyzes the attachment of serine to tRNA(Ser). Is also able to aminoacylate tRNA(Sec) with serine, to form the misacylated tRNA L-seryl-tRNA(Sec), which will be further converted into selenocysteinyl-tRNA(Sec)
Cellular LocationMitochondrion matrix
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG Reactions
L-Serine + Adenosine triphosphate + tRNA(Ser) → Adenosine monophosphate + Ser-tRNA(Ser) + Pyrophosphate
Metabolites
YMDB IDNameView
YMDB00097Adenosine monophosphateShow
YMDB00109Adenosine triphosphateShow
YMDB00112L-SerineShow
YMDB00219PyrophosphateShow
GO Classification
Component
cell part
intracellular part
cytoplasm
Function
ligase activity
binding
nucleoside binding
purine nucleoside binding
serine-tRNA ligase activity
adenyl nucleotide binding
adenyl ribonucleotide binding
ATP binding
ligase activity, forming carbon-oxygen bonds
ligase activity, forming aminoacyl-tRNA and related compounds
catalytic activity
aminoacyl-tRNA ligase activity
nucleotide binding
Process
macromolecule metabolic process
cellular macromolecule metabolic process
RNA metabolic process
ncRNA metabolic process
biosynthetic process
tRNA metabolic process
tRNA aminoacylation
tRNA aminoacylation for protein translation
macromolecule biosynthetic process
cellular macromolecule biosynthetic process
translation
seryl-tRNA aminoacylation
metabolic process
Gene Properties
Chromosome Locationchromosome 8
LocusYHR011W
Gene Sequence>1341 bp ATGATTATAAGGCGCTTATTTTCAATTTCAAATCGCTCATTCTTCTTGAAGAAACCTCAA TTTGATGTAAAAAAAATAATAGAGATGATTCCTCAGTACCAAACTTCTATCCAGAATAGA GAGCTGATAGAGGCGGATAGTATTATACGAAGCTTACAACTGTTGGGTGAACGGTATCAA AATATAAAAGAGATTGATAAAGTTATTGCGGATATTCAAATACAGAGGAAATCAATTGAG GCTCAAATCAAAAAGGATAAAACAAAAATTACGGAATACTCAGCTGCGCTGAAGGCCCTG AAAGAACAGTACAACGATCAAAATAGCAAATCGTCGGAGCTGAAAAAGAAAATCTTGGAG ACCTGCAAATCACTTCCAAATACCTTGGATCCTACGGTCCCATTAGATGCCCCACAGATT GAACAATGGATAAACCCTTTAAAAACACATAAAACTTCAGAAGCTCAGGCGCATGTTGAT ATCATGCTTAAAAAGAATATGTTAGACCTACAGACTGCCTCGAACGTTACAGGAATGTCA TGGTACTATCTATTGAATGACGGAGCACGTCTCGAACAAGCATTGGTAGCATATGCATTG AAAAAGGCAAACGAAAATGGGTTTTCAAGCTGCGTACCGCCAAGCATCACGAAGAAGGAG TTAATAGATGCATGTGGATTTAATCCAAGAGATATGAATAATGAAAGGCAAATTTACGCT CTTCAAGACACCAATTTAGGATTGGTGGCTACCGCGGAGATACCTTTGGCAGGTCTAGGG GCAAACAAAGTTCTAGAGTTAAACTCGGGAGAATGTTCTAAGAAACTAGTTGGAGTAAGT AGATGTTACAGAGCTGAGGCAGGTGCCAGGGGAAAAGATACGAAAGGTCTCTATCGCGTT CATGAGTTTACTAAAGTAGAATTATTTTGCTGGAGCAAGCCAGAAACCAGTGCAAAGGTC CTTGAGGAAATAAAGCAATTTCAGATTTCTGTAGTTGAGGAATTAGGAATACCGGCCAAA GTACTAAATATGCCATCAAACGATCTTGGTAATCCCGCTTTCAAGAAATACGACATCGAA GCTTGGATGCCAGGAAGGGGGAAATTTGGCGAGATAAGTAGTGCCTCCAATTGTACCGAT TTCCAAAGTAGAAGATTAAATACAAAGTACAGGGACGATAACACAGGAAAGCTAGAATAT GTGCACACGCTGAATGGCACAGCAATGGCTATCCCAAGAGTGATAGTAGCACTAGTAGAA AATTTCTATGACCCAAGCACCGGTAAGATATCTGTTCCTGAATGTTTGAGGGAGTTTATG AATGGCCAACGATACATTTAA
Protein Properties
Pfam Domain Function
Protein Residues446
Protein Molecular Weight50389.5
Protein Theoretical pI9.06
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Seryl-tRNA synthetase, mitochondrial MIIRRLFSISNRSFFLKKPQFDVKKIIEMIPQYQTSIQNRELIEADSIIRSLQLLGERYQ NIKEIDKVIADIQIQRKSIEAQIKKDKTKITEYSAALKALKEQYNDQNSKSSELKKKILE TCKSLPNTLDPTVPLDAPQIEQWINPLKTHKTSEAQAHVDIMLKKNMLDLQTASNVTGMS WYYLLNDGARLEQALVAYALKKANENGFSSCVPPSITKKELIDACGFNPRDMNNERQIYA LQDTNLGLVATAEIPLAGLGANKVLELNSGECSKKLVGVSRCYRAEAGARGKDTKGLYRV HEFTKVELFCWSKPETSAKVLEEIKQFQISVVEELGIPAKVLNMPSNDLGNPAFKKYDIE AWMPGRGKFGEISSASNCTDFQSRRLNTKYRDDNTGKLEYVHTLNGTAMAIPRVIVALVE NFYDPSTGKISVPECLREFMNGQRYI
References
External Links
ResourceLink
Saccharomyces Genome Database DIA4
Uniprot IDP38705
Uniprot NameSYSM_YEAST
GenBank Gene IDAY558105
Genebank Protein ID45270100
General Reference
  • Johnston, M., Andrews, S., Brinkman, R., Cooper, J., Ding, H., Dover, J., Du, Z., Favello, A., Fulton, L., Gattung, S., et, a. l. .. (1994). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome VIII." Science 265:2077-2082.8091229
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106