You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameMitochondrial carrier protein LEU5
SynonymsNot Available
Gene NameLEU5
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in binding
Specific FunctionRequired for the accumulation of coenzyme A in the mitochondrial matrix
Cellular LocationMitochondrion inner membrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00045Coenzyme AShow
GO Classification
Component
membrane
organelle membrane
organelle inner membrane
mitochondrial inner membrane
cell part
Function
binding
Process
transmembrane transport
establishment of localization
transport
Gene Properties
Chromosome Locationchromosome 8
LocusYHR002W
Gene Sequence>1074 bp ATGACGCGAGATAGCCCAGATTCTAACGACAGCTATAAGCATATAAACAAGAATACTACA CAAAAAACCTCGTTTGATAGAAATTCATTCGATTATATTGTACGATCGGGATTAGCTGGA GGTATATCAGGTTCATGTGCGAAAACACTAATCGCACCCTTAGATAGAATAAAAATTTTA TTTCAAACATCAAATCCGCACTACACAAAGTACACAGGCTCACTAATAGGATTAGTAGAG GCAGCCAAGCATATATGGATCAATGATGGGGTAAGGGGGTTTTTTCAAGGCCATTCAGCA ACCCTTTTAAGGATTTTTCCATATGCTGCTGTCAAATTTGTTGCTTATGAACAGATTAGG AATACCTTGATTCCCTCAAAAGAATTTGAGTCACATTGGAGAAGGTTGGTGAGTGGTTCA CTGGCAGGATTATGCAGTGTTTTCATAACATATCCGTTAGATCTCGTGAGGGTTAGGTTA GCATATGAAACAGAACATAAGAGAGTAAAGCTAGGAAGAATAATCAAGAAAATATATAAG GAACCAGCTTCAGCCACGCTAATCAAAAATGATTATATTCCTAACTGGTTTTGTCATTGG TGTAATTTTTATAGGGGTTATGTTCCAACTGTACTTGGCATGATACCATATGCAGGTGTT TCCTTTTTTGCTCACGATTTACTTCATGATGTGCTGAAGAGTCCTTTCTTTGCCCCTTAT TCAGTATTAGAACTTTCAGAAGATGATGAATTGGAAAGAGTACAGAAAAAGCAGAGAAGG CCTTTGCGTACGTGGGCTGAATTGATCTCTGGTGGTCTAGCTGGTATGGCCTCCCAAACG GCAGCATATCCATTTGAAATTATTAGGAGAAGGCTCCAAGTAAGTGCACTGTCACCAAAA ACTATGTATGATCATAAATTTCAATCGATATCTGAAATTGCTCACATAATATTTAAAGAA CGTGGAGTACGTGGATTTTTTGTTGGTCTAAGCATAGGTTATATTAAAGTAACACCTATG GTTGCATGTAGTTTTTTCGTCTATGAAAGAATGAAATGGAATTTTGGCATTTAA
Protein Properties
Pfam Domain Function
Protein Residues357
Protein Molecular Weight40824.89844
Protein Theoretical pI10.0
Signalling Regions
  • None
Transmembrane Regions
  • 31-47
  • 103-119
  • 136-153
  • 208-228
  • 269-285
  • 325-347
Protein Sequence>Mitochondrial carrier protein LEU5 MTRDSPDSNDSYKHINKNTTQKTSFDRNSFDYIVRSGLAGGISGSCAKTLIAPLDRIKIL FQTSNPHYTKYTGSLIGLVEAAKHIWINDGVRGFFQGHSATLLRIFPYAAVKFVAYEQIR NTLIPSKEFESHWRRLVSGSLAGLCSVFITYPLDLVRVRLAYETEHKRVKLGRIIKKIYK EPASATLIKNDYIPNWFCHWCNFYRGYVPTVLGMIPYAGVSFFAHDLLHDVLKSPFFAPY SVLELSEDDELERVQKKQRRPLRTWAELISGGLAGMASQTAAYPFEIIRRRLQVSALSPK TMYDHKFQSISEIAHIIFKERGVRGFFVGLSIGYIKVTPMVACSFFVYERMKWNFGI
References
External Links
ResourceLink
Saccharomyces Genome Database LEU5
Uniprot IDP38702
Uniprot NameLEU5_YEAST
GenBank Gene IDU10555
Genebank Protein ID500815
General Reference
  • Johnston, M., Andrews, S., Brinkman, R., Cooper, J., Ding, H., Dover, J., Du, Z., Favello, A., Fulton, L., Gattung, S., et, a. l. .. (1994). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome VIII." Science 265:2077-2082.8091229
  • Prohl, C., Pelzer, W., Diekert, K., Kmita, H., Bedekovics, T., Kispal, G., Lill, R. (2001). "The yeast mitochondrial carrier Leu5p and its human homologue Graves' disease protein are required for accumulation of coenzyme A in the matrix." Mol Cell Biol 21:1089-1097.11158296