You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameExopolyphosphatase
Synonyms
  • ExopolyPase
  • Metaphosphatase
Gene NamePPX1
Enzyme Class
Biological Properties
General FunctionInvolved in pyrophosphatase activity
Specific FunctionDegradation of inorganic polyphosphates
Cellular LocationCytoplasmic
SMPDB PathwaysNot Available
KEGG Pathways
Purine metabolismec00230 Map00230
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00907phosphateShow
GO Classification
Component
intracellular part
cytoplasm
cell part
Function
binding
ion binding
cation binding
metal ion binding
transition metal ion binding
hydrolase activity
hydrolase activity, acting on acid anhydrides
manganese ion binding
hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
pyrophosphatase activity
catalytic activity
Process
Not Available
Gene Properties
Chromosome Locationchromosome 8
LocusYHR201C
Gene Sequence>1194 bp ATGTCGCCTTTGAGAAAGACGGTTCCTGAATTTTTGGCACACTTAAAATCACTGCCAATT TCAAAAATTGCAAGCAACGATGTGTTAACAATATGTGTTGGTAACGAATCAGCAGATATG GACTCAATTGCTAGTGCAATCACTTATTCGTACTGCCAATACATATATAATGAAGGTACT TACTCGGAGGAGAAAAAGAAAGGAAGCTTTATTGTCCCAATTATCGACATTCCTAGGGAA GACCTCAGTTTAAGAAGAGACGTAATGTATGTCCTAGAAAAACTGAAAATTAAGGAGGAG GAATTATTCTTCATTGAAGATTTAAAGAGCTTGAAGCAAAATGTCTCCCAGGGTACTGAA TTAAACTCTTACTTGGTAGATAATAACGATACACCAAAGAATTTGAAAAATTATATAGAT AACGTCGTTGGCATTATAGACCACCATTTTGACTTGCAAAAACATTTGGATGCTGAACCT CGGATTGTAAAAGTATCCGGCAGTTGCTCATCGCTGGTTTTTAACTACTGGTATGAAAAA TTGCAAGGTGACCGTGAAGTGGTGATGAACATTGCACTACTTTTGATGGGGGCCATCTTA ATAGACACTTCAAATATGAGGCGCAAAGTCGAGGAAAGTGATAAATTAGCTATCGAGAGA TGCCAAGCTGTTCTTAGTGGTGCGGTTAATGAAGTCTCTGCGCAAGGTTTAGAGGACAGC AGTGAGTTTTACAAAGAGATAAAATCAAGAAAGAACGATATTAAAGGATTTTCGGTAAGC GATATTTTAAAGAAGGACTACAAACAATTCAATTTCCAAGGAAAGGGACACAAAGGGTTA GAGATTGGTTTTTCATCAATAGTAAAAAGAATGTCTTGGCTATTCAATGAACACGGTGGT GAAGCAGATTTCGTCAACCAGTGCAGAAGATTCCAGGCGGAGAGGGGGCTCGATGTATTG GTTCTGTTGACTTCATGGAGGAAAGCTGGCGATTCACACAGAGAATTGGTCATATTGGGA GACTCTAACGTGGTACGTGAACTCATTGAAAGGGTTAGCGACAAGCTCCAACTTCAATTA TTTGGGGGCAATCTTGATGGAGGTGTGGCGATGTTTAAGCAACTGAACGTCGAGGCCACC AGAAAGCAAGTCGTCCCCTATTTAGAGGAAGCGTACTCAAACCTGGAAGAGTGA
Protein Properties
Pfam Domain Function
Protein Residues397
Protein Molecular Weight45051.0
Protein Theoretical pI5.39
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Exopolyphosphatase MSPLRKTVPEFLAHLKSLPISKIASNDVLTICVGNESADMDSIASAITYSYCQYIYNEGT YSEEKKKGSFIVPIIDIPREDLSLRRDVMYVLEKLKIKEEELFFIEDLKSLKQNVSQGTE LNSYLVDNNDTPKNLKNYIDNVVGIIDHHFDLQKHLDAEPRIVKVSGSCSSLVFNYWYEK LQGDREVVMNIAPLLMGAILIDTSNMRRKVEESDKLAIERCQAVLSGAVNEVSAQGLEDS SEFYKEIKSRKNDIKGFSVSDILKKDYKQFNFQGKGHKGLEIGLSSIVKRMSWLFNEHGG EADFVNQCRRFQAERGLDVLVLLTSWRKAGDSHRELVILGDSNVVRELIERVSDKLQLQL FGGNLDGGVAMFKQLNVEATRKQVVPYLEEAYSNLEE
References
External Links
ResourceLink
Saccharomyces Genome Database PPX1
Uniprot IDP38698
Uniprot NamePPX1_YEAST
GenBank Gene IDL28711
Genebank Protein ID453695
General Reference
  • Wurst, H., Shiba, T., Kornberg, A. (1995). "The gene for a major exopolyphosphatase of Saccharomyces cerevisiae." J Bacteriol 177:898-906.7860598
  • Johnston, M., Andrews, S., Brinkman, R., Cooper, J., Ding, H., Dover, J., Du, Z., Favello, A., Fulton, L., Gattung, S., et, a. l. .. (1994). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome VIII." Science 265:2077-2082.8091229
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106