You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameInosine-5'-monophosphate dehydrogenase IMD2
Synonyms
  • IMP dehydrogenase
  • IMPD
  • IMPDH
Gene NameIMD2
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionInosine 5'-phosphate + NAD(+) + H(2)O = xanthosine 5'-phosphate + NADH
Cellular LocationNot Available
SMPDB PathwaysNot Available
KEGG Pathways
Purine metabolismec00230 Map00230
SMPDB ReactionsNot Available
KEGG Reactions
Inosinic acid + NAD + waterNADH + Xanthylic acid + hydron
Metabolites
YMDB IDNameView
YMDB00110NADShow
YMDB00143NADHShow
YMDB00289Xanthylic acidShow
YMDB00352Inosinic acidShow
YMDB00412NAD(+)Show
YMDB00862hydronShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
oxidoreductase activity, acting on CH-OH group of donors
oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
IMP dehydrogenase activity
catalytic activity
oxidoreductase activity
Process
metabolic process
oxidation reduction
Gene Properties
Chromosome Locationchromosome 8
LocusYHR216W
Gene Sequence>1572 bp ATGGCCGCCATTAGAGACTACAAGACCGCACTAGACTTTACCAAGAGCCTACCAAGACCG GATGGTTTGTCAGTGCAGGAATTGATGGACTCCAAGATCAGAGGTGGGTTGACTTATAAC GATTTTTTAATCTTACCAGGTTTAGTCGATTTTGCGTCCTCTGAAGTTAGCCTACAGACC AAGCTAACCAGGAATATTACTTTAAATATTCCATTAGTTTCCTCTCCAATGGACACGGTG ACAGAGTCAGAAATGGCCACTTTTATGGCTCTGTTGGGTGGTATCGGTTTCATTCACCAT AACTGTACCCCAGAGGACCAAGCTGACATGGTCAGAAGAGTCAAGAACTATGAAAATGGG TTTATTAACAACCCTATAGTGATTTCTCCAACTACGACCGTTGGTGAAGCTAAGAGCATG AAGGAAAAGTATGGATTTGCAGGCTTCCCTGTCACGACAGATGGAAAGAGAAATGCAAAG TTGGTGGGTGTCATCACCTCTCGTGATATACAATTCGTTGAGGACAACTCTTTACTCGTT CAGGATGTCATGACCAAAAACCCTGTTACCGGCGCACAAGGTATCACATTATCAGAAGGT AACGAAATTCTAAAGAAAATCAAAAAGGGTAGGCTATTGGTTGTTGATGAAAAGGGTAAC TTAGTTTCTATGCTTTCCCGAACTGATTTAATGAAAAATCAGAACTACCCATTAGCGTCC AAATCTGCCAACACCAAGCAACTGTTATGTGGTGCTTCTATTGGGACTATGGACGCTGAT AAAGAAAGACTAAGATTATTGGTAAAAGCTGGGTTGGATGTCGTCATATTGGATTCATCC CAAGGAAACTCTATCTTCGAATTGAACATGCTCAAGTGGGTCAAAGAGAGTTTCCCAGGT CTGGAAGTCATCGCTGGTAACGTTGTCACCAGGGAACAAGCTGCCAATTTGATTGCTGCC GGTGCGGACGGTTTGAGAATTGGTATGGGAACTGGCTCTATTTGTATTACCCAAGAAGTT ATGGCTTGTGGTAGGCCACAAGGTACAGCCGTCTACAATGTGTGTGAATTTGCTAACCAA TTCGGTGTTCCATGTATGGCTGATGGTGGTGTTCAAAACATTGGTCATATTACCAAAGCT TTGGCTCTTGGTTCTTCTACTGTTATGATGGGTGGTATGTTGGCCGGTACTACCGAATCA CCAGGTGAATATTTCTATCAAGATGGTAAAAGATTGAAGGCGTATCGTGGTATGGGCTCC ATTGACGCCATGCAAAAGACTGGTACCAAAGGTAATGCATCTACCTCCCGTTACTTTTCC GAATCAGACAGTGTTTTGGTCGCACAAGGTGTCTCCGGTGCTGTCGTTGACAAAGGATCC ATTAAGAAATTTATTCCATATTTGTACAATGGTTTACAACATTCCTGTCAAGACATCGGC TGTAGGTCGCTAACTTTATTAAAGAATAATGTTCAAAGGGGTAAAGTTAGATTTGAATTC AGAACCGCTTCTGCTCAACTAGAAGGTGGCGTTCATAATTTACATTCTTACGAAAAGCGT TTACATAACTGA
Protein Properties
Pfam Domain Function
Protein Residues523
Protein Molecular Weight56529.5
Protein Theoretical pI8.67
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Inosine-5'-monophosphate dehydrogenase IMD2 MAAIRDYKTALDFTKSLPRPDGLSVQELMDSKIRGGLTYNDFLILPGLVDFASSEVSLQT KLTRNITLNIPLVSSPMDTVTESEMATFMALLGGIGFIHHNCTPEDQADMVRRVKNYENG FINNPIVISPTTTVGEAKSMKEKYGFAGFPVTTDGKRNAKLVGVITSRDIQFVEDNSLLV QDVMTKNPVTGAQGITLSEGNEILKKIKKGRLLVVDEKGNLVSMLSRTDLMKNQNYPLAS KSANTKQLLCGASIGTMDADKERLRLLVKAGLDVVILDSSQGNSIFELNMLKWVKESFPG LEVIAGNVVTREQAANLIAAGADGLRIGMGTGSICITQEVMACGRPQGTAVYNVCEFANQ FGVPCMADGGVQNIGHITKALALGSSTVMMGGMLAGTTESPGEYFYQDGKRLKAYRGMGS IDAMQKTGTKGNASTSRYFSESDSVLVAQGVSGAVVDKGSIKKFIPYLYNGLQHSCQDIG CRSLTLLKNNVQRGKVRFEFRTASAQLEGGVHNLHSYEKRLHN
References
External Links
ResourceLink
Saccharomyces Genome Database IMD2
Uniprot IDP38697
Uniprot NameIMDH2_YEAST
GenBank Gene IDU00029
Genebank Protein ID458916
General Reference
  • Johnston, M., Andrews, S., Brinkman, R., Cooper, J., Ding, H., Dover, J., Du, Z., Favello, A., Fulton, L., Gattung, S., et, a. l. .. (1994). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome VIII." Science 265:2077-2082.8091229
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106