You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameProbable glucose transporter HXT5
SynonymsNot Available
Gene NameHXT5
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in transmembrane transporter activity
Specific FunctionProbable glucose transporter
Cellular LocationMembrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00286D-GlucoseShow
YMDB00657D-FructoseShow
YMDB00862hydronShow
YMDB00894D-MannoseShow
GO Classification
Component
cell part
membrane
membrane part
intrinsic to membrane
integral to membrane
Function
transmembrane transporter activity
substrate-specific transmembrane transporter activity
transporter activity
Process
transmembrane transport
establishment of localization
transport
Gene Properties
Chromosome Locationchromosome 8
LocusYHR096C
Gene Sequence>1779 bp ATGTCGGAACTTGAAAACGCTCATCAAGGCCCCTTGGAAGGGTCTGCTACTGTGAGCACA AATTCTAACTCATACAACGAGAAGTCAGGAAACTCGACTGCTCCTGGTACCGCCGGTTAC AACGATAATTTGGCACAAGCTAAACCCGTCTCAAGTTACATTTCCCATGAAGGCCCTCCC AAAGACGAACTGGAAGAGCTTCAGAAGGAGGTTGACAAACAACTAGAGAAGAAATCGAAG TCGGATTTACTATTTGTATCCGTCTGCTGTTTGATGGTTGCTTTTGGTGGGTTCGTGTTT GGGTGGGATACTGGTACTATATCTGGTTTTGTCAGGCAAACAGACTTCATTAGGCGATTT GGCAGCACCCGTGCAAACGGGACTACCTATCTTTCCGATGTCAGAACCGGTTTGATGGTT TCTATTTTCAACATCGGCTGCGCTATCGGAGGTATAGTTTTGTCAAAGCTCGGTGATATG TATGGACGTAAGATTGGTCTGATGACTGTTGTCGTCATTTACTCAATTGGGATCATCATC CAAATCGCCTCCATTGACAAATGGTATCAATATTTCATTGGAAGAATCATCTCAGGACTG GGCGTTGGTGGTATTACAGTTTTGGCGCCTATGCTAATTTCTGAAGTGTCGCCTAAGCAG TTGCGTGGTACTCTGGTTTCATGTTACCAATTAATGATCACTTTCGGTATCTTTTTGGGA TATTGTACTAATTTTGGTACCAAGAATTACTCAAACTCTGTCCAATGGAGGGTACCATTA GGCTTATGCTTTGCATGGTCTATTTTTATGATTGTTGGTATGACGTTCGTTCCTGAATCC CCACGTTATCTGGTAGAAGTGGGAAAAATTGAAGAGGCCAAGCGGTCCTTAGCAAGAGCT AACAAAACCACTGAAGACTCTCCTTTAGTAACTTTAGAAATGGAGAACTATCAGTCTTCT ATTGAAGCTGAGAGATTGGCGGGCTCTGCTTCTTGGGGGGAATTGGTTACTGGTAAGCCC CAGATGTTCAGACGTACACTAATGGGTATGATGATTCAATCTTTACAACAGCTGACAGGT GACAATTACTTCTTTTACTATGGTACTACAATTTTCCAGGCTGTTGGTTTGGAAGATTCA TTTGAAACTGCTATTGTTTTGGGTGTTGTTAATTTTGTTTCGACTTTTTTCTCGCTATAT ACCGTCGATCGTTTTGGTCGTCGTAATTGTTTGTTATGGGGCTGTGTAGGTATGATTTGT TGCTATGTCGTCTATGCCTCTGTTGGTGTTACCAGATTATGGCCAAACGGTCAAGATCAA CCATCTTCAAAGGGTGCTGGTAACTGTATGATTGTTTTCGCATGTTTCTACATTTTCTGT TTCGCTACCACTTGGGCCCCCGTTGCCTATGTCCTTATCTCTGAGTCGTATCCCTTAAGA GTACGTGGTAAAGCAATGTCGATTGCAAGTGCCTGTAACTGGATTTGGGGGTTCTTGATC AGTTTTTTCACTCCATTTATTACTTCAGCAATCAATTTCTATTATGGCTATGTCTTTATG GGTTGTATGGTGTTCGCATACTTTTATGTGTTCTTCTTTGTTCCAGAGACAAAGGGCTTA ACATTAGAAGAAGTCAACGAAATGTATGAAGAAAATGTGCTACCTTGGAAGTCTACCAAA TGGATCCCACCATCTAGGAGAACAACAGATTATGACCTAGACGCTACTAGAAATGATCCG AGACCATTTTATAAAAGGATGTTCACTAAAGAAAAATAA
Protein Properties
Pfam Domain Function
Protein Residues592
Protein Molecular Weight66251.0
Protein Theoretical pI7.66
Signalling Regions
  • None
Transmembrane Regions
  • 82-102
  • 138-158
  • 165-185
  • 196-216
  • 223-243
  • 258-278
  • 362-378
  • 385-402
  • 410-430
  • 453-473
  • 491-511
  • 513-533
Protein Sequence>Probable glucose transporter HXT5 MSELENAHQGPLEGSATVSTNSNSYNEKSGNSTAPGTAGYNDNLAQAKPVSSYISHEGPP KDELEELQKEVDKQLEKKSKSDLLFVSVCCLMVAFGGFVFGWDTGTISGFVRQTDFIRRF GSTRANGTTYLSDVRTGLMVSIFNIGCAIGGIVLSKLGDMYGRKIGLMTVVVIYSIGIII QIASIDKWYQYFIGRIISGLGVGGITVLAPMLISEVSPKQLRGTLVSCYQLMITFGIFLG YCTNFGTKNYSNSVQWRVPLGLCFAWSIFMIVGMTFVPESPRYLVEVGKIEEAKRSLARA NKTTEDSPLVTLEMENYQSSIEAERLAGSASWGELVTGKPQMFRRTLMGMMIQSLQQLTG DNYFFYYGTTIFQAVGLEDSFETAIVLGVVNFVSTFFSLYTVDRFGRRNCLLWGCVGMIC CYVVYASVGVTRLWPNGQDQPSSKGAGNCMIVFACFYIFCFATTWAPVAYVLISESYPLR VRGKAMSIASACNWIWGFLISFFTPFITSAINFYYGYVFMGCMVFAYFYVFFFVPETKGL TLEEVNEMYEENVLPWKSTKWIPPSRRTTDYDLDATRNDPRPFYKRMFTKEK
References
External Links
ResourceLink
Saccharomyces Genome Database HXT5
Uniprot IDP38695
Uniprot NameHXT5_YEAST
GenBank Gene IDU00060
Genebank Protein ID487940
General Reference
  • Johnston, M., Andrews, S., Brinkman, R., Cooper, J., Ding, H., Dover, J., Du, Z., Favello, A., Fulton, L., Gattung, S., et, a. l. .. (1994). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome VIII." Science 265:2077-2082.8091229
  • Peng, J., Schwartz, D., Elias, J. E., Thoreen, C. C., Cheng, D., Marsischky, G., Roelofs, J., Finley, D., Gygi, S. P. (2003). "A proteomics approach to understanding protein ubiquitination." Nat Biotechnol 21:921-926.12872131
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258
  • Chi, A., Huttenhower, C., Geer, L. Y., Coon, J. J., Syka, J. E., Bai, D. L., Shabanowitz, J., Burke, D. J., Troyanskaya, O. G., Hunt, D. F. (2007). "Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry." Proc Natl Acad Sci U S A 104:2193-2198.17287358
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956