You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameHistidinol-phosphatase
Synonyms
  • HolPase
Gene NameHIS2
Enzyme Class
Biological Properties
General FunctionInvolved in histidinol-phosphatase activity
Specific FunctionL-histidinol phosphate + H(2)O = L-histidinol + phosphate
Cellular LocationCytoplasmic
SMPDB Pathways
Histidine BiosynthesisPW002418 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Histidine metabolismec00340 Map00340
SMPDB Reactions
L-histidinol phosphate + waterL-histidinol + phosphate
KEGG Reactions
L-histidinol phosphate + waterphosphate + L-histidinol
Metabolites
YMDB IDNameView
YMDB00123L-histidinol phosphateShow
YMDB00702L-histidinolShow
YMDB00890waterShow
YMDB00907phosphateShow
GO Classification
Component
Not Available
Function
hydrolase activity
hydrolase activity, acting on ester bonds
phosphoric ester hydrolase activity
phosphatase activity
histidinol-phosphatase activity
catalytic activity
Process
metabolic process
cellular metabolic process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
histidine family amino acid metabolic process
histidine metabolic process
histidine biosynthetic process
Gene Properties
Chromosome Locationchromosome 6
LocusYFR025C
Gene Sequence>1008 bp ATGCACTCACACCATTCACACTCCGGTGACTATAGTGCCCACGGTACGGACCCTTTGGAT TCCGTGGTCGATCAAGTGGTCAACCTCAACTTTCACACGTACTGTTTGACAGAGCACATA CCAAGAATTGAGGCCAAGTTTATATACCCCGAAGAGCAGTCATTGGGCAAGAATCCTGAG GAAGTCATAACCAAGCTAGAAACATCGTTCAAGAATTTCATGAGTCATGCGCAAGAAATC AAGACTCGTTATGCTGATAGACCCGATGTGCGGACTAAATTCATTATAGGAATGGAGATC GAAAGTTGTGACATGGCTCATATCGAATATGCAAAGCGACTCATGAAGGAGAATAATGAT ATTTTGAAGTTTTGTGTGGGTTCGGTCCATCACGTCAACGGGATCCCTATTGATTTCGAC CAACAACAATGGTACAATTCATTGCATTCCTTCAATGATAATTTGAAACATTTTCTCCTG TCTTACTTCCAATCACAGTACGAAATGCTGATCAATATTAAACCGTTGGTCGTGGGTCAC TTCGACCTTTACAAATTATTTTTGCCCAATGACATGCTAGTAAACCAGAAATCGGGCAAC TGCAACGAAGAAACCGGAGTTCCTGTAGCTTCACTGGACGTCATCAGTGAATGGCCAGAA ATATACGATGCAGTTGTAAGAAATTTACAATTTATAGACTCCTATGGCGGCGCAATTGAA ATCAATACGTCCGCATTAAGAAAGCGCCTCGAGGAGCCGTACCCCAGCAAAACCTTATGT AATCTGGTCAAGAAGCACTGTGGATCCAGATTTGTTCTAAGTGATGACGCACACGGCGTG GCGCAAGTGGGTGTGTGCTATGACAAGGTAAAGAAATACATAGTAGACGTGCTACAATTA GAGTATATTTGCTACCTTGAGGAAAGCCAATCACCAGAGAATCTGTTAACTGTAAAGAGA TTACCCATTTCGCAATTCGTTAATGATCCCTTTTGGGCCAATATATAA
Protein Properties
Pfam Domain Function
Protein Residues335
Protein Molecular Weight38581.5
Protein Theoretical pI5.81
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Histidinol-phosphatase MHSHHSHSGDYSAHGTDPLDSVVDQVVNLNFHTYCLTEHIPRIEAKFIYPEEQSLGKNPE EVITKLETSFKNFMSHAQEIKTRYADRPDVRTKFIIGMEIESCDMAHIEYAKRLMKENND ILKFCVGSVHHVNGIPIDFDQQQWYNSLHSFNDNLKHFLLSYFQSQYEMLINIKPLVVGH FDLYKLFLPNDMLVNQKSGNCNEETGVPVASLDVISEWPEIYDAVVRNLQFIDSYGGAIE INTSALRKRLEEPYPSKTLCNLVKKHCGSRFVLSDDAHGVAQVGVCYDKVKKYIVDVLQL EYICYLEESQSPENLLTVKRLPISQFVNDPFWANI
References
External Links
ResourceLink
Saccharomyces Genome Database HIS2
Uniprot IDP38635
Uniprot NameHIS9_YEAST
GenBank Gene IDD50617
Genebank Protein ID836780
General Reference
  • Malone, R. E., Kim, S., Bullard, S. A., Lundquist, S., Hutchings-Crow, L., Cramton, S., Lutfiyya, L., Lee, J. (1994). "Analysis of a recombination hotspot for gene conversion occurring at the HIS2 gene of Saccharomyces cerevisiae." Genetics 137:5-18.8056323
  • Eki, T., Naitou, M., Hagiwara, H., Abe, M., Ozawa, M., Sasanuma, S., Sasanuma, M., Tsuchiya, Y., Shibata, T., Watanabe, K., et, a. l. .. (1996). "Fifteen open reading frames in a 30.8 kb region of the right arm of chromosome VI from Saccharomyces cerevisiae." Yeast 12:177-190.8686381
  • Murakami, Y., Naitou, M., Hagiwara, H., Shibata, T., Ozawa, M., Sasanuma, S., Sasanuma, M., Tsuchiya, Y., Soeda, E., Yokoyama, K., et, a. l. .. (1995). "Analysis of the nucleotide sequence of chromosome VI from Saccharomyces cerevisiae." Nat Genet 10:261-268.7670463
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106