You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
Name1,3-beta-glucan synthase component FKS1
Synonyms
  • 1,3-beta-D-glucan-UDP glucosyltransferase
  • Calcineurin dependent protein 1
  • Calcofluor white hypersensitivity protein 53
  • Echinocandin target gene protein 1
  • FK506 sensitivity protein 1
  • Glucan synthase of cerevisiae protein 1
  • Papulacandin B resistance protein 1
Gene NameFKS1
Enzyme Class
Biological Properties
General FunctionInvolved in 1,3-beta-D-glucan synthase activity
Specific FunctionAlternate catalytic subunit of the 1,3-beta-glucan synthase (GS). Synthesizes 1,3-beta-glucan, a major structural component of the yeast cell wall. Involved in cell wall synthesis, maintenance and cell wall remodeling
Cellular LocationMitochondrion. Cell membrane; Multi-pass membrane protein (Potential).
SMPDB Pathways
Starch and sucrose metabolismPW002481 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Starch and sucrose metabolismec00500 Map00500
SMPDB Reactions
1,3-beta-D-Glucan + Uridine 5'-diphosphateUridine diphosphate glucose + 1,3-beta-D-Glucan
KEGG Reactions
Uridine diphosphate glucoseUridine 5'-diphosphate + (1->3)-beta-D-glucan + hydron
Metabolites
YMDB IDNameView
YMDB00212Uridine diphosphate glucoseShow
YMDB00307Uridine 5'-diphosphateShow
YMDB00415UDP-D-glucoseShow
YMDB00862hydronShow
YMDB163141,3-beta-D-GlucanShow
GO Classification
Component
membrane
macromolecular complex
protein complex
1,3-beta-glucan synthase complex
cell part
Function
UDP-glycosyltransferase activity
UDP-glucosyltransferase activity
1,3-beta-glucan synthase activity
catalytic activity
transferase activity
transferase activity, transferring glycosyl groups
Process
primary metabolic process
carbohydrate metabolic process
polysaccharide metabolic process
glucan metabolic process
cellular glucan metabolic process
beta-glucan metabolic process
1,3-beta-glucan metabolic process
1,3-beta-glucan biosynthetic process
metabolic process
Gene Properties
Chromosome Locationchromosome 12
LocusYLR342W
Gene Sequence>5631 bp ATGAACACTGATCAACAACCTTATCAGGGCCAAACGGACTATACCCAGGGGCCAGATAAC GGGCAAAGTCAGGAACAAGACTATGACCAATATGGCCAGCCTTTGTATCCTTCACAAGCT GATGGTTACTACGATCCAAATGTCGCTGCTGGTACTGAAGCTGATATGTATGGTCAACAG CCACCAAACGAGTCTTACGACCAAGACTACACAAACGGTGAATACTATGGTCAACCGCCA AATATGGCTGCTCAAGACGGTGAAAACTTTTCGGATTTTAGCAGTTACGGCCCTCCTGGA ACACCTGGATATGATAGCTATGGTGGTCAGTATACCCCTTCTCAAATGAGTTATGGAGAA CCAAATTCGTCGGGTACCTCGACTCCAATTTACGGTAATTATGACCCAAATGCTATCGCT ATGGCTCTGCCAAATGAACCTTATCCTGCTTGGACTGCTGACTCTCAATCTCCCGTTTCG ATCGAGCAAATCGAAGATATCTTTATTGATTTGACCAACAGACTCGGGTTCCAAAGAGAC TCCATGAGAAATATGTTTGATCATTTTATGGTTCTCTTGGACTCTAGGTCCTCGAGAATG TCTCCTGATCAAGCTTTACTATCTTTACATGCCGACTACATTGGTGGCGATACTGCTAAC TATAAAAAATGGTATTTCGCTGCTCAGTTAGATATGGATGATGAAGTTGGTTTTAGAAAT ATGAGTCTTGGAAAACTCTCCAGGAAGGCAAGAAAAGCTAAGAAGAAAAACAAGAAAGCA ATGGAAGAGGCCAATCCTGAAGACACTGAAGAAACTTTAAACAAGATTGAAGGTGACAAC TCCCTAGAGGCTGCTGATTTTAGATGGAAGGCCAAGATGAACCAGTTATCTCCTTTGGAA AGAGTTCGCCATATTGCATTATATCTATTATGTTGGGGTGAAGCTAATCAAGTCAGATTC ACTGCTGAATGTTTATGTTTTATCTACAAGTGTGCTCTTGACTACTTGGATTCCCCTCTT TGCCAACAACGCCAAGAACCTATGCCAGAAGGTGATTTCTTGAATAGGGTCATTACGCCA ATTTATCATTTCATCAGAAATCAAGTTTATGAAATTATTGATGGTCGTTTTGTCAAGCGT GAAAGAGATCATAACAAAATTGTCGGTTATGATGATTTAAACCAATTGTTCTGGTATCCA GAAGGTATTGCAAAGATTGTTCTTGAAGATGGAACAAAATTGATAGAACTCCCATTGGAA GAACGTTATTTAAGATTAGGCGATGTCGTCTGGGATGATGTATTTTTCAAAACATATAAA GAGACCCGTACTTGGTTGCATTTGGTCACCAACTTCAACCGTATTTGGGTTATGCATATC TCCATTTTCTGGATGTACTTTGCATATAATTCACCAACATTTTACACTCATAACTACCAA CAATTGGTCGACAACCAACCTTTGGCTGCTTACAGATGGGCATCTTGCGCATTAGGTGGT ACTGTTGCAAGTTTGATTCAAATTGTCGCTACTTTGTGTGAATGGTCATTCGTTCCAAGA AAATGGGCTGGTGCTCAACATCTATCTCGTAGATTCTGGTTTTTATGCATCATCTTTGGT ATTAATTTGGGTCCTATTATTTTCGTTTTTGCCTACGACAAAGACACAGTCTATTCTACT GCTGCACACGTTGTTGCTGCTGTTATGTTCTTTGTTGCGGTTGCTACCATCATATTCTTC TCCATTATGCCATTGGGGGGATTGTTTACGTCATATATGAAAAAATCTACAAGGCGTTAT GTTGCTTCTCAAACATTCACTGCTGCATTTGCCCCTCTACATGGGTTAGATAGATGGATG TCCTATTTAGTTTGGGTTACTGTTTTTGCCGCCAAATATTCAGAATCGTACTACTTTCTA GTTTTATCTTTGAGAGATCCAATTAGAATTTTGTCCACCACTGCAATGAGGTGTACAGGT GAATACTGGTGGGGTGCGGTACTTTGTAAAGTGCAACCCAAGATTGTCTTAGGTTTGGTT ATCGCTACCGACTTCATTCTTTTCTTCTTGGATACCTACTTATGGTACATTATTGTGAAT ACCATTTTCTCTGTTGGGAAATCTTTCTATTTAGGTATTTCTATCTTAACACCATGGAGA AATATCTTCACAAGATTGCCAAAAAGAATATACTCCAAGATTTTGGCTACTACTGATATG GAGATTAAATACAAACCAAAGGTTTTGATTTCTCAAGTATGGAATGCCATCATTATTTCA ATGTACAGAGAACATCTCTTAGCCATCGACCATGTACAAAAATTACTATATCATCAAGTT CCATCTGAAATCGAAGGTAAAAGAACTTTGAGAGCTCCTACCTTCTTTGTTTCTCAAGAT GACAATAATTTTGAGACTGAATTTTTCCCTAGGGATTCAGAGGCTGAGCGTCGTATTTCT TTCTTTGCTCAATCTTTGTCTACTCCAATTCCCGAACCACTTCCAGTTGATAACATGCCA ACGTTCACAGTATTGACTCCTCACTACGCGGAAAGAATTCTGCTGTCATTAAGAGAAATT ATTCGTGAAGATGACCAATTTTCTAGAGTTACTCTTTTAGAATATCTAAAACAATTACAT CCCGTTGAATGGGAATGTTTTGTTAAGGATACTAAGATTTTGGCTGAAGAAACCGCTGCC TATGAAGGAAATGAAAATGAAGCTGAAAAGGAAGATGCTTTGAAATCTCAAATCGATGAT TTGCCATTTTATTGTATTGGTTTTAAATCTGCTGCTCCAGAATATACACTTCGTACGAGA ATTTGGGCTTCTTTGAGGTCGCAGACTCTATATCGTACTATTTCAGGGTTCATGAATTAT TCAAGAGCTATCAAATTACTGTATCGTGTGGAAAATCCTGAAATTGTTCAAATGTTTGGT GGTAATGCTGAAGGCTTAGAAAGAGAGCTAGAAAAGATGGCAAGAAGAAAGTTCAAATTT TTGGTCTCTATGCAGAGATTGGCTAAATTCAAACCACATGAACTGGAAAATGCTGAGTTT TTGTTGAGAGCTTACCCAGACTTACAAATTGCCTACTTGGATGAAGAGCCACCTTTGACT GAAGGTGAGGAGCCAAGAATCTATTCCGCTTTGATTGATGGACATTGTGAAATTCTAGAT AATGGTCGTAGACGTCCCAAATTTAGAGTTCAATTATCTGGTAACCCAATTCTTGGTGAT GGTAAATCTGATAACCAAAACCATGCTTTGATTTTTTACAGAGGTGAATACATTCAATTA ATTGATGCCAACCAAGATAACTACTTGGAAGAATGTCTGAAGATTAGATCTGTTTTGGCT GAATTTGAGGAATTGAACGTTGAACAAGTTAATCCATATGCTCCCGGTTTAAGGTATGAG GAGCAAACAACTAATCATCCTGTTGCTATTGTTGGTGCCAGAGAATACATTTTCTCTGAA AACTCTGGTGTGCTGGGTGATGTGGCCGCTGGTAAAGAACAAACTTTTGGTACATTATTT GCGCGTACTTTATCTCAAATTGGTGGTAAATTGCATTATGGTCATCCGGATTTCATTAAT GCTACGTTTATGACCACTAGAGGTGGTGTTTCCAAAGCACAAAAGGGTTTGCATTTGAAC GAAGATATTTATGCTGGTATGAATGCTATGCTTCGTGGTGGTCGTATCAAGCATTGTGAG TATTATCAATGTGGTAAAGGTAGAGATTTGGGTTTCGGTACAATTCTAAATTTCACTACA AAGATTGGTGCTGGTATGGGTGAACAAATGTTATCCCGTGAATATTATTATCTGGGTACC CAATTACCAGTGGACCGTTTCCTAACATTCTATTATGCCCATCCTGGTTTCCATTTGAAC AACTTGTTCATTCAATTATCTTTGCAAATGTTTATGTTGACTTTGGTGAATTTATCTTCC TTGGCCCATGAATCTATTATGTGTATTTACGATAGGAACAAACCAAAAACAGATGTTTTG TTTCCAATTGGGTGTTACAACTTCCAACCTGCGGTTGATTGGGTGAGACGTTATACATTG TCTATTTTCATTGTTTTCTGGATTGCCTTCGTTCCTATTGTTGTTCAAGAACTAATTGAA CGTGGTCTATGGAAAGCCACCCAAAGATTTTTCTGCCACCTATTATCATTATCCCCTATG TTCGAAGTGTTTGCGGGCCAAATCTACTCTTCTGCGTTATTAAGTGATTTAGCAATTGGC GGTGCTCGTTATATATCCACCGGTCGTGGTTTTGCAACTTCTCGTATACCATTTTCAATT TTGTATTCAAGATTTGCAGGGTCTGCTATCTACATGGGTGCAAGATCTATATTAATGTTG CTGTTCGGTACTGTCGCACATTGGCAAGCTCCACTACTGTGGTTTTGGGCCTCTCTATCT TCATTAATTTTTGCGCCTTTCGTTTTCAATCCACATCAGTTTGCTTGGGAAGATTTCTTT TTGGATTACAGGGATTATATCAGATGGTTATCAAGAGGTAATAATCAATATCATAGAAAC TCGTGGATTGGTTACGTGAGGATGTCTAGAGCACGTATTACTGGGTTTAAACGTAAACTG GTTGGCGATGAATCTGAGAAAGCTGCTGGTGACGCAAGCAGAGCTCATAGAACCAATTTG ATCATGGCTGAAATCATACCCTGTGCAATTTATGCAGCTGGTTGTTTTATTGCCTTCACG TTTATTAATGCTCAAACCGGTGTCAAGACTACTGATGATGATAGGGTGAATTCTGTTTTA CGTATCATCATTTGTACCTTGGCGCCAATCGCCGTTAACCTCGGTGTTCTATTCTTCTGT ATGGGTATGTCATGCTGCTCTGGTCCCTTATTTGGTATGTGTTGTAAGAAGACAGGTTCT GTAATGGCTGGAATTGCCCACGGTGTTGCTGTTATTGTCCACATTGCCTTTTTCATTGTC ATGTGGGTTTTGGAGAGCTTCAACTTTGTTAGAATGTTAATCGGAGTCGTTACTTGTATC CAATGTCAAAGACTCATTTTTCATTGCATGACAGCGTTAATGTTGACTCGTGAATTCAAA AACGATCATGCTAATACAGCTTTCTGGACTGGTAAGTGGTATGGTAAAGGTATGGGTTAC ATGGCTTGGACCCAGCCAAGTAGAGAATTAACCGCCAAGGTAATTGAGCTTTCAGAATTT GCAGCAGATTTTGTTCTAGGTCATGTGATTTTAATCTGTCAACTGCCACTCATTATAATC CCAAAAATAGATAAATTCCACTCGATTATGCTATTCTGGCTAAAGCCTTCTCGTCAAATT CGTCCCCCAATTTACTCTCTAAAGCAAAGTCGTTTGCGTAAGCGTATGGTCAAGAAGTAC TGCTCTTTGTACTTTTTAGTATTGGCTATTTTTGCAGGATGCATTATTGGTCCTGCTGTA GCCTCTGCTAAGATCCACGATCAAATTGGAGATTCATTGACAGGCGTTGTTCACAATCTA TTCCAACCAGTAAATACAACCAATAATGACACTGGTTTCCAAATGTCAACTTATCAAAGT CACTACTATACTCATACGCCATCATTAAAGACCTGGTCAACTATAAAATAA
Protein Properties
Pfam Domain Function
Protein Residues1876
Protein Molecular Weight214849.0
Protein Theoretical pI7.23
Signalling Regions
  • None
Transmembrane Regions
  • 455-475
  • 493-513
  • 532-552
  • 564-584
  • 622-642
  • 679-699
  • 1359-1379
  • 1445-1465
  • 1470-1490
  • 1561-1581
  • 1602-1622
  • 1644-1664
  • 1673-1695
  • 1803-1823
Protein Sequence>1,3-beta-glucan synthase component FKS1 MNTDQQPYQGQTDYTQGPGNGQSQEQDYDQYGQPLYPSQADGYYDPNVAAGTEADMYGQQ PPNESYDQDYTNGEYYGQPPNMAAQDGENFSDFSSYGPPGTPGYDSYGGQYTASQMSYGE PNSSGTSTPIYGNYDPNAIAMALPNEPYPAWTADSQSPVSIEQIEDIFIDLTNRLGFQRD SMRNMFDHFMVLLDSRSSRMSPDQALLSLHADYIGGDTANYKKWYFAAQLDMDDEIGFRN MSLGKLSRKARKAKKKNKKAMEEANPEDTEETLNKIEGDNSLEAADFRWKAKMNQLSPLE RVRHIALYLLCWGEANQVRFTAECLCFIYKCALDYLDSPLCQQRQEPMPEGDFLNRVITP IYHFIRNQVYEIVDGRFVKRERDHNKIVGYDDLNQLFWYPEGIAKIVLEDGTKLIELPLE ERYLRLGDVVWDDVFFKTYKETRTWLHLVTNFNRIWVMHISIFWMYFAYNSPTFYTHNYQ QLVDNQPLAAYKWASCALGGTVASLIQIVATLCEWSFVPRKWAGAQHLSRRFWFLCIIFG INLGPIIFVFAYDKDTVYSTAAHVVAAVMFFVAVATIIFFSIMPLGGLFTSYMKKSTRRY VASQTFTAAFAPLHGLDRWMSYLVWVTVFAAKYSESYYFLVLSLRDPIRILSTTAMRCTG EYWWGAVLCKVQPKIVLGLVIATDFILFFLDTYLWYIIVNTIFSVGKSFYLGISILTPWR NIFTRLPKRIYSKILATTDMEIKYKPKVLISQVWNAIIISMYREHLLAIDHVQKLLYHQV PSEIEGKRTLRAPTFFVSQDDNNFETEFFPRDSEAERRISFFAQSLSTPIPEPLPVDNMP TFTVLTPHYAERILLSLREIIREDDQFSRVTLLEYLKQLHPVEWECFVKDTKILAEETAA YEGNENEAEKEDALKSQIDDLPFYCIGFKSAAPEYTLRTRIWASLRSQTLYRTISGFMNY SRAIKLLYRVENPEIVQMFGGNAEGLERELEKMARRKFKFLVSMQRLAKFKPHELENAEF LLRAYPDLQIAYLDEEPPLTEGEEPRIYSALIDGHCEILDNGRRRPKFRVQLSGNPILGD GKSDNQNHALIFYRGEYIQLIDANQDNYLEECLKIRSVLAEFEELNVEQVNPYAPGLRYE EQTTNHPVAIVGAREYIFSENSGVLGDVAAGKEQTFGTLFARTLSQIGGKLHYGHPDFIN ATFMTTRGGVSKAQKGLHLNEDIYAGMNAMLRGGRIKHCEYYQCGKGRDLGFGTILNFTT KIGAGMGEQMLSREYYYLGTQLPVDRFLTFYYAHPGFHLNNLFIQLSLQMFMLTLVNLSS LAHESIMCIYDRNKPKTDVLVPIGCYNFQPAVDWVRRYTLSIFIVFWIAFVPIVVQELIE RGLWKATQRFFCHLLSLSPMFEVFAGQIYSSALLSDLAIGGARYISTGRGFATSRIPFSI LYSRFAGSAIYMGARSMLMLLFGTVAHWQAPLLWFWASLSSLIFAPFVFNPHQFAWEDFF LDYRDYIRWLSRGNNQYHRNSWIGYVRMSRARITGFKRKLVGDESEKAAGDASRAHRTNL IMAEIIPCAIYAAGCFIAFTFINAQTGVKTTDDDRVNSVLRIIICTLAPIAVNLGVLFFC MGMSCCSGPLFGMCCKKTGSVMAGIAHGVAVIVHIAFFIVMWVLESFNFVRMLIGVVTCI QCQRLIFHCMTALMLTREFKNDHANTAFWTGKWYGKGMGYMAWTQPSRELTAKVIELSEF AADFVLGHVILICQLPLIIIPKIDKFHSIMLFWLKPSRQIRPPIYSLKQTRLRKRMVKKY CSLYFLVLAIFAGCIIGPAVASAKIHKHIGDSLDGVVHNLFQPINTTNNDTGSQMSTYQS HYYTHTPSLKTWSTIK
References
External Links
ResourceLink
Saccharomyces Genome Database FKS1
Uniprot IDP38631
Uniprot NameFKS1_YEAST
GenBank Gene IDAY395693
Genebank Protein ID40457585
General Reference
  • Eng, W. K., Faucette, L., McLaughlin, M. M., Cafferkey, R., Koltin, Y., Morris, R. A., Young, P. R., Johnson, R. K., Livi, G. P. (1994). "The yeast FKS1 gene encodes a novel membrane protein, mutations in which confer FK506 and cyclosporin A hypersensitivity and calcineurin-dependent growth." Gene 151:61-71.7530227
  • Douglas, C. M., Foor, F., Marrinan, J. A., Morin, N., Nielsen, J. B., Dahl, A. M., Mazur, P., Baginsky, W., Li, W., el-Sherbeini, M., et, a. l. .. (1994). "The Saccharomyces cerevisiae FKS1 (ETG1) gene encodes an integral membrane protein which is a subunit of 1,3-beta-D-glucan synthase." Proc Natl Acad Sci U S A 91:12907-12911.7528927
  • Inoue, S. B., Takewaki, N., Takasuka, T., Mio, T., Adachi, M., Fujii, Y., Miyamoto, C., Arisawa, M., Furuichi, Y., Watanabe, T. (1995). "Characterization and gene cloning of 1,3-beta-D-glucan synthase from Saccharomyces cerevisiae." Eur J Biochem 231:845-854.7649185
  • Ram, A. F., Brekelmans, S. S., Oehlen, L. J., Klis, F. M. (1995). "Identification of two cell cycle regulated genes affecting the beta 1,3-glucan content of cell walls in Saccharomyces cerevisiae." FEBS Lett 358:165-170.7828729
  • Castro, C., Ribas, J. C., Valdivieso, M. H., Varona, R., del Rey, F., Duran, A. (1995). "Papulacandin B resistance in budding and fission yeasts: isolation and characterization of a gene involved in (1,3)beta-D-glucan synthesis in Saccharomyces cerevisiae." J Bacteriol 177:5732-5739.7592316
  • Garrett-Engele, P., Moilanen, B., Cyert, M. S. (1995). "Calcineurin, the Ca2+/calmodulin-dependent protein phosphatase, is essential in yeast mutants with cell integrity defects and in mutants that lack a functional vacuolar H(+)-ATPase." Mol Cell Biol 15:4103-4114.7542741
  • Ohyama, T., Miyakoshi, S., Isono, F. (2004). "FKS1 mutations responsible for selective resistance of Saccharomyces cerevisiae to the novel 1,3-beta-glucan synthase inhibitor arborcandin C." Antimicrob Agents Chemother 48:319-322.14693557
  • Johnston, M., Hillier, L., Riles, L., Albermann, K., Andre, B., Ansorge, W., Benes, V., Bruckner, M., Delius, H., Dubois, E., Dusterhoft, A., Entian, K. D., Floeth, M., Goffeau, A., Hebling, U., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hilger, F., Kleine, K., Kotter, P., Louis, E. J., Messenguy, F., Mewes, H. W., Hoheisel, J. D., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XII." Nature 387:87-90.9169871
  • Parent, S. A., Nielsen, J. B., Morin, N., Chrebet, G., Ramadan, N., Dahl, A. M., Hsu, M. J., Bostian, K. A., Foor, F. (1993). "Calcineurin-dependent growth of an FK506- and CsA-hypersensitive mutant of Saccharomyces cerevisiae." J Gen Microbiol 139:2973-2984.7510323
  • Mazur, P., Morin, N., Baginsky, W., el-Sherbeini, M., Clemas, J. A., Nielsen, J. B., Foor, F. (1995). "Differential expression and function of two homologous subunits of yeast 1,3-beta-D-glucan synthase." Mol Cell Biol 15:5671-5681.7565718
  • Mazur, P., Baginsky, W. (1996). "In vitro activity of 1,3-beta-D-glucan synthase requires the GTP-binding protein Rho1." J Biol Chem 271:14604-14609.8662910
  • Qadota, H., Python, C. P., Inoue, S. B., Arisawa, M., Anraku, Y., Zheng, Y., Watanabe, T., Levin, D. E., Ohya, Y. (1996). "Identification of yeast Rho1p GTPase as a regulatory subunit of 1,3-beta-glucan synthase." Science 272:279-281.8602515
  • Utsugi, T., Minemura, M., Hirata, A., Abe, M., Watanabe, D., Ohya, Y. (2002). "Movement of yeast 1,3-beta-glucan synthase is essential for uniform cell wall synthesis." Genes Cells 7:1-9.11856368
  • Sekiya-Kawasaki, M., Abe, M., Saka, A., Watanabe, D., Kono, K., Minemura-Asakawa, M., Ishihara, S., Watanabe, T., Ohya, Y. (2002). "Dissection of upstream regulatory components of the Rho1p effector, 1,3-beta-glucan synthase, in Saccharomyces cerevisiae." Genetics 162:663-676.12399379
  • Dijkgraaf, G. J., Abe, M., Ohya, Y., Bussey, H. (2002). "Mutations in Fks1p affect the cell wall content of beta-1,3- and beta-1,6-glucan in Saccharomyces cerevisiae." Yeast 19:671-690.12185837
  • Hitchcock, A. L., Auld, K., Gygi, S. P., Silver, P. A. (2003). "A subset of membrane-associated proteins is ubiquitinated in response to mutations in the endoplasmic reticulum degradation machinery." Proc Natl Acad Sci U S A 100:12735-12740.14557538
  • Sickmann, A., Reinders, J., Wagner, Y., Joppich, C., Zahedi, R., Meyer, H. E., Schonfisch, B., Perschil, I., Chacinska, A., Guiard, B., Rehling, P., Pfanner, N., Meisinger, C. (2003). "The proteome of Saccharomyces cerevisiae mitochondria." Proc Natl Acad Sci U S A 100:13207-13212.14576278
  • Lesage, G., Sdicu, A. M., Menard, P., Shapiro, J., Hussein, S., Bussey, H. (2004). "Analysis of beta-1,3-glucan assembly in Saccharomyces cerevisiae using a synthetic interaction network and altered sensitivity to caspofungin." Genetics 167:35-49.15166135
  • Reinders, J., Zahedi, R. P., Pfanner, N., Meisinger, C., Sickmann, A. (2006). "Toward the complete yeast mitochondrial proteome: multidimensional separation techniques for mitochondrial proteomics." J Proteome Res 5:1543-1554.16823961
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956