You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameCTP synthase 2
Synonyms
  • CTP synthetase 2
  • UTP--ammonia ligase 2
Gene NameURA8
Enzyme Class
Biological Properties
General FunctionInvolved in CTP synthase activity
Specific FunctionCatalyzes the ATP-dependent amination of UTP to CTP with either L-glutamine or ammonia as the source of nitrogen. Plays an important role in the regulation of phospholipid synthesis
Cellular LocationCytoplasm
SMPDB Pathways
Pyrimidine metabolismPW002469 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Pyrimidine metabolismec00240 Map00240
SMPDB ReactionsNot Available
KEGG Reactions
Uridine triphosphate + Adenosine triphosphate + water + L-Glutaminephosphate + L-Glutamic acid + hydron + ADP + Cytidine triphosphate
Uridine triphosphate + Adenosine triphosphate + Ammoniumphosphate + hydron + ADP + Cytidine triphosphate
Metabolites
YMDB IDNameView
YMDB00002L-GlutamineShow
YMDB00091AmmoniaShow
YMDB00109Adenosine triphosphateShow
YMDB00271L-Glutamic acidShow
YMDB00279Cytidine triphosphateShow
YMDB00326Uridine triphosphateShow
YMDB00423AmmoniumShow
YMDB00862hydronShow
YMDB00890waterShow
YMDB00907phosphateShow
YMDB00914ADPShow
GO Classification
Component
Not Available
Function
ligase activity, forming carbon-nitrogen bonds
catalytic activity
CTP synthase activity
ligase activity
Process
nitrogen compound metabolic process
cellular nitrogen compound metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
nucleobase, nucleoside and nucleotide metabolic process
nucleoside phosphate metabolic process
nucleotide metabolic process
metabolic process
pyrimidine nucleotide metabolic process
pyrimidine nucleotide biosynthetic process
Gene Properties
Chromosome Locationchromosome 10
LocusYJR103W
Gene Sequence>1695 bp ATGAAATACGTTGTTGTTTCTGGTGGTGTTATCTCAGGTATTGGTAAGGGTGTTTTAGCG TCCTCTACAGGGATGCTACTGAAAACCCTCGGCCTAAAGGTTACTTCCATCAAGATTGAC CCATATATGAATATTGACGCCGGGACGATGTCTCCCTTGGAACATGGTGAGTGTTTTGTA CTTGATGATGGTGGGGAAACGGACTTGGATCTCGGTAATTACGAGCGGTACCTCGGTATT ACCTTAAGCAGGGACCACAACATCACCACCGGTAAGATATACTCCCACGTAATTTCCAGA GAAAGGAGAGGTGATTATTTAGGTAAGACAGTTCAAATTGTTCCTCATTTGACTAACGCA ATTCAGGATTGGATTCAACGTGTTTCAAAAATTCCAGTGGATGACACAGGATTAGAACCA GACGTCTGTATCATCGAGTTAGGTGGTACGGTCGGTGACATTGAGAGTGCGCCCTTCGTG GAAGCATTACGACAATTTCAGTTCGAAGTTGGAAGAGAGAATTTCGCCCTGATCCATGTT TCACTTGTGCCCGTCATTCATGGTGAACAGAAGACGAAACCCACCCAAGCAGCAATCAAA GATTTAAGGTCATTAGGGCTTATTCCCGATATGATTGCCTGCAGATGCAGCGAAGAACTT AACAGGAGCACTATTGACAAGATTGCCATGTTTTGCCATGTGGGGCCGGAGCAAGTGGTC AACGTTCATGATGTTAACTCCACGTACCACGTTCCCTTATTGCTGCTAAAGCAACATATG ATCGACTACCTCCATTCAAGGTTGAAATTAGGTGAAGTGCCTCTAACCTTGGAAGACAAG GAAAGAGGGTCTCAATTATTGACTAACTGGGAAAACATGACCAAAAACCTAGATGATTCT GATGATGTTGTCAAGATTGCTCTTGTGGGAAAATACACTAATTTGAAGGATTCCTACCTA TCTGTGACCAAATCCTTAGAACACGCAAGCATGAAGTGCCGTCGTCAGCTAGAAATCCTC TGGGTAGAGGCAAGTAACCTAGAGCCCGAAACTCAAGAGGTGGACAAGAACAAGTTCCAC GATTCATGGAATAAGCTCAGTTCCGCCGACGGAATTTTGGTTCCTGGTGGATTTGGCACG AGAGGTATTGAAGGTATGATTCTTGCTGCCAAATGGGCCCGTGAATCCGGTGTTCCCTTT CTTGGTGTCTGTCTTGGATTACAAGTTGCCGCTATCGAGTTCGCCCGCAATGTGATAGGC CGCCCAAACAGCAGTTCTACAGAATTTTTGGACGAGACACTACTAGCTCCTGAAGACCAA GTAGTCATATACATGCCCGAGATCGACAAGGAACACATGGGTGGCACGATGAGATTGGGT TTGAGGCCTACCATTTTCCAACCGAACTCAGAATGGAGCAACATAAGGAAGCTTTATGGT GAAGTTAATGAGGTGCATGAGAGACATCGTCATCGCTATGAGATAAACCCGAAAATAGTG AATGATATGGAGTCTCGTGGCTTTATTTTTGTTGGTAAGGACGAGACGGGCCAGCGTTGC GAAATATTCGAATTGAAAGGCCATCCATACTACGTGGGCACTCAATACCATCCAGAGTAT ACATCGAAGGTGCTGGAACCATCAAGACCGTTTTGGGGGCTTGTGGCCGCAGCTCCGGCA CACTTGGTGAAGTGA
Protein Properties
Pfam Domain Function
Protein Residues564
Protein Molecular Weight63055.69922
Protein Theoretical pI6.0
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>CTP synthase 2 MKYVVVSGGVISGIGKGVLASSTGMLLKTLGLKVTSIKIDPYMNIDAGTMSPLEHGECFV LDDGGETDLDLGNYERYLGITLSRDHNITTGKIYSHVISRERRGDYLGKTVQIVPHLTNA IQDWIQRVSKIPVDDTGLEPDVCIIELGGTVGDIESAPFVEALRQFQFEVGRENFALIHV SLVPVIHGEQKTKPTQAAIKDLRSLGLIPDMIACRCSEELNRSTIDKIAMFCHVGPEQVV NVHDVNSTYHVPLLLLKQHMIDYLHSRLKLGEVPLTLEDKERGSQLLTNWENMTKNLDDS DDVVKIALVGKYTNLKDSYLSVTKSLEHASMKCRRQLEILWVEASNLEPETQEVDKNKFH DSWNKLSSADGILVPGGFGTRGIEGMILAAKWARESGVPFLGVCLGLQVAAIEFARNVIG RPNSSSTEFLDETLLAPEDQVVIYMPEIDKEHMGGTMRLGLRPTIFQPNSEWSNIRKLYG EVNEVHERHRHRYEINPKIVNDMESRGFIFVGKDETGQRCEIFELKGHPYYVGTQYHPEY TSKVLEPSRPFWGLVAAAPAHLVK
References
External Links
ResourceLink
Saccharomyces Genome Database URA8
Uniprot IDP38627
Uniprot NameURA8_YEAST
GenBank Gene IDZ49603
Genebank Protein ID1015810
General Reference
  • Ozier-Kalogeropoulos, O., Adeline, M. T., Yang, W. L., Carman, G. M., Lacroute, F. (1994). "Use of synthetic lethal mutants to clone and characterize a novel CTP synthetase gene in Saccharomyces cerevisiae." Mol Gen Genet 242:431-439.8121398
  • Galibert, F., Alexandraki, D., Baur, A., Boles, E., Chalwatzis, N., Chuat, J. C., Coster, F., Cziepluch, C., De Haan, M., Domdey, H., Durand, P., Entian, K. D., Gatius, M., Goffeau, A., Grivell, L. A., Hennemann, A., Herbert, C. J., Heumann, K., Hilger, F., Hollenberg, C. P., Huang, M. E., Jacq, C., Jauniaux, J. C., Katsoulou, C., Karpfinger-Hartl, L., et, a. l. .. (1996). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome X." EMBO J 15:2031-2049.8641269
  • Nadkarni, A. K., McDonough, V. M., Yang, W. L., Stukey, J. E., Ozier-Kalogeropoulos, O., Carman, G. M. (1995). "Differential biochemical regulation of the URA7- and URA8-encoded CTP synthetases from Saccharomyces cerevisiae." J Biol Chem 270:24982-24988.7559626
  • Ostrander, D. B., O'Brien, D. J., Gorman, J. A., Carman, G. M. (1998). "Effect of CTP synthetase regulation by CTP on phospholipid synthesis in Saccharomyces cerevisiae." J Biol Chem 273:18992-19001.9668079
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106