You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameGMP synthase [glutamine-hydrolyzing]
Synonyms
  • GMP synthetase
  • Glutamine amidotransferase
Gene NameGUA1
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionATP + xanthosine 5'-phosphate + L-glutamine + H(2)O = AMP + diphosphate + GMP + L-glutamate
Cellular LocationCytoplasm
SMPDB PathwaysNot Available
KEGG Pathways
Purine metabolismec00230 Map00230
SMPDB ReactionsNot Available
KEGG Reactions
Adenosine triphosphate + Xanthylic acid + water + L-GlutamineAdenosine monophosphate + Pyrophosphate + Guanosine monophosphate + L-Glutamic acid + hydron
Metabolites
YMDB IDNameView
YMDB00002L-GlutamineShow
YMDB00097Adenosine monophosphateShow
YMDB00109Adenosine triphosphateShow
YMDB00219PyrophosphateShow
YMDB00261Guanosine monophosphateShow
YMDB00271L-Glutamic acidShow
YMDB00289Xanthylic acidShow
YMDB00862hydronShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
adenyl nucleotide binding
carbon-nitrogen ligase activity, with glutamine as amido-N-donor
adenyl ribonucleotide binding
ATP binding
GMP synthase (glutamine-hydrolyzing) activity
catalytic activity
binding
nucleoside binding
ligase activity
purine nucleoside binding
ligase activity, forming carbon-nitrogen bonds
Process
purine ribonucleoside monophosphate biosynthetic process
nitrogen compound metabolic process
biosynthetic process
cellular nitrogen compound metabolic process
cellular metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
cellular amino acid and derivative metabolic process
GMP biosynthetic process
nucleobase, nucleoside and nucleotide metabolic process
cellular amino acid metabolic process
nucleoside phosphate metabolic process
glutamine family amino acid metabolic process
nucleotide metabolic process
glutamine metabolic process
purine nucleotide metabolic process
metabolic process
purine nucleotide biosynthetic process
purine nucleoside monophosphate biosynthetic process
Gene Properties
Chromosome Locationchromosome 13
LocusYMR217W
Gene Sequence>1578 bp ATGGCTGCCGGTGAACAAGTTTCTAACATGTTTGACACTATCTTAGTGTTAGACTTTGGT TCTCAATACTCTCATTTGATTACCAGAAGATTAAGAGAGTTTAACATCTATGCTGAGATG TTGCCATGCACTCAGAAGATCTCTGAGTTGGGCTGGACTCCAAAGGGTGTCATTCTTTCT GGTGGTCCATATTCCGTATACGCTGAAGACGCTCCACACGTAGACCATGCTATCTTTGAT TTGAACGTTCCAATCCTGGGTATCTGTTACGGTATGCAAGAATTGGCTTGGATTAATGGT AAACAAGTTGGTCGTGGTGACAAGAGAGAGTACGGTCCTGCCACTTTGAAGGTGATTGAC GATTCCAACTCTCTATTCAAAGGTATGAACGACTCTACTGTCTGGATGTCTCACGGTGAT AAATTGCACGGCTTGCCAACTGGTTACAAGACCATTGCCACCTCCGATAACTCCCCATAC TGTGGTATTGTCCACGAAACTAAGCCAATCTATGGTATCCAATTCCACCCAGAAGTTACA CATTCTACCCAAGGTAAGACTCTTTTGAAAAACTTCGCCGTTGATTTGTGTCACGCTAAG CAAAACTGGACTATGGAAAACTTTATCGACACTGAAATAAACAGAATCAGAAAACTGGTC GGTCCAACTGCTGAAGTCATTGGTGCTGTTTCCGGTGGTGTTGATTCTACTGTTGCATCC AAATTGATGACAGAAGCCATCGGTGATAGATTCCATGCCATTTTGGTCGATAACGGTGTT TTAAGATTAAATGAAGCTGCTAACGTTAAAAAGACTCTTGTCGAAGGTTTAGGTATCAAC TTGATGGTTGTCGATGCTTCCGAAGAATTTTTAAGCAAATTGAAGGGTGTCACTGACCCA GAAAAGAAGAGAAAGATTATTGGTAACACATTTATCCACGTCTTTGAAAGAGAAGCTGAA AAAATTAAGCCAAGAGATGGTAAGGAGATTCAATTCCTGTTACAAGGTACTCTTTATCCA GATGTCATCGAATCCATTTCTTTCAAAGGTCCTTCTCAAACCATTAAAACTCATCACAAC GTCGGTGGTTTACTAGAGAACATGAAATTAAAGCTAATTGAACCATTGAGAGAACTGTTC AAAGACGAAGTCAGGCATCTAGGTGAATTATTAGGAATCCCTCATGATCTAGTCTGGAGA CACCCTTTCCCTGGTCCAGGTATTGCTATTCGTGTTCTAGGTGAAGTTACTAAGGAACAA GTCGAAATAGCAAGAAAAGCTGACAACATTTACATTGAAGAAATCAAGAAGGCCGGCTTA TACAACCAAATTTCCCAAGCCTTTGCCTGTTTGTTGCCCGTTAAATCCGTTGGTGTTATG GGTGACCAAAGAACCTATGATCAAGTTATTGCTTTGAGGGCCATTGAAACTACTGATTTC ATGACTGCTGACTGGTTCCCATTCGAACACAGTTTCTTGAAGAAAGTCGCCTCAAGAATT GTCAATGAAGTCGATGGGGTTGCTAGGGTCACTTACGATATAACTTCCAAACCTCCTGCA ACTGTTGAATGGGAATGA
Protein Properties
Pfam Domain Function
Protein Residues525
Protein Molecular Weight58481.80078
Protein Theoretical pI6.47
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>GMP synthase [glutamine-hydrolyzing] MAAGEQVSNMFDTILVLDFGSQYSHLITRRLREFNIYAEMLPCTQKISELGWTPKGVILS GGPYSVYAEDAPHVDHAIFDLNVPILGICYGMQELAWINGKQVGRGDKREYGPATLKVID DSNSLFKGMNDSTVWMSHGDKLHGLPTGYKTIATSDNSPYCGIVHETKPIYGIQFHPEVT HSTQGKTLLKNFAVDLCHAKQNWTMENFIDTEINRIRKLVGPTAEVIGAVSGGVDSTVAS KLMTEAIGDRFHAILVDNGVLRLNEAANVKKTLVEGLGINLMVVDASEEFLSKLKGVTDP EKKRKIIGNTFIHVFEREAEKIKPKDGKEIQFLLQGTLYPDVIESISFKGPSQTIKTHHN VGGLLENMKLKLIEPLRELFKDEVRHLGELLGIPHDLVWRHPFPGPGIAIRVLGEVTKEQ VEIARKADNIYIEEIKKAGLYNQISQAFACLLPVKSVGVMGDQRTYDQVIALRAIETTDF MTADWFPFEHSFLKKVASRIVNEVDGVARVTYDITSKPPATVEWE
References
External Links
ResourceLink
Saccharomyces Genome Database GUA1
Uniprot IDP38625
Uniprot NameGUAA_YEAST
GenBank Gene IDX70397
Genebank Protein ID460064
General Reference
  • Dujardin, G., Kermorgant, M., Slonimski, P. P., Boucherie, H. (1994). "Cloning and sequencing of the GMP synthetase-encoding gene of Saccharomyces cerevisiae." Gene 139:127-132.8112582
  • Bowman, S., Churcher, C., Badcock, K., Brown, D., Chillingworth, T., Connor, R., Dedman, K., Devlin, K., Gentles, S., Hamlin, N., Hunt, S., Jagels, K., Lye, G., Moule, S., Odell, C., Pearson, D., Rajandream, M., Rice, P., Skelton, J., Walsh, S., Whitehead, S., Barrell, B. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII." Nature 387:90-93.9169872
  • Boucherie, H., Dujardin, G., Kermorgant, M., Monribot, C., Slonimski, P., Perrot, M. (1995). "Two-dimensional protein map of Saccharomyces cerevisiae: construction of a gene-protein index." Yeast 11:601-613.7483834
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956