You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameRibose-phosphate pyrophosphokinase 2
Synonyms
  • Phosphoribosyl pyrophosphate synthase 2
Gene NamePRS2
Enzyme Class
Biological Properties
General FunctionInvolved in magnesium ion binding
Specific Function5-phosphoribose 1-diphosphate synthase involved in nucleotide, histidine, and tryptophan biosynthesis. Active in heteromultimeric complexes with other 5-phosphoribose 1- diphosphate synthases (PRS2, PRS3, PRS4 and PRS5)
Cellular LocationCytoplasm
SMPDB Pathways
Histidine BiosynthesisPW002418 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Pentose phosphate pathwayec00030 Map00030
Purine metabolismec00230 Map00230
SMPDB Reactions
D-Ribose 5-phosphate + Adenosine triphosphateAdenosine monophosphate + hydron + Phosphoribosyl pyrophosphate
KEGG Reactions
Adenosine triphosphate + alpha-D-ribose 5-phosphateAdenosine monophosphate + hydron + Phosphoribosyl pyrophosphate
Metabolites
YMDB IDNameView
YMDB00097Adenosine monophosphateShow
YMDB00109Adenosine triphosphateShow
YMDB00119D-Ribose 5-phosphateShow
YMDB00402Phosphoribosyl pyrophosphateShow
YMDB00650alpha-D-ribose 5-phosphateShow
YMDB00862hydronShow
GO Classification
Component
Not Available
Function
catalytic activity
diphosphotransferase activity
transferase activity
binding
ribose phosphate diphosphokinase activity
ion binding
transferase activity, transferring phosphorus-containing groups
cation binding
metal ion binding
magnesium ion binding
Process
biosynthetic process
metabolic process
ribonucleoside monophosphate biosynthetic process
nitrogen compound metabolic process
cellular nitrogen compound metabolic process
nucleoside metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
nucleobase, nucleoside and nucleotide metabolic process
cellular biosynthetic process
nucleoside phosphate metabolic process
nucleoside monophosphate metabolic process
nucleotide metabolic process
nucleoside monophosphate biosynthetic process
nucleotide biosynthetic process
Gene Properties
Chromosome Locationchromosome 5
LocusYER099C
Gene Sequence>957 bp ATGTCTACAAACAGTATTAAGTTGTTAGCTGGTAACTCACATCCTGGGCTTGCTGAGCTT ATTTCCCAAAGGCTTGGTGTACCGTTATCTAAAGTGGGGGTATATCAGTATTCAAATAAA GAGACGTCTGTTACAATAGGGGAAAGCATTCGTGATGAAGACGTATATATCATCCAAACT GGTTACGGGGAACATGAAATCAACGATTTCTTAATGGAATTACTTATCTTAATTCACGCT TGTAAGACGGCATCAGTCAGAAGAATTACGGCAGTAATACCAAATTTCCCTTATGCTAGA CAAGATAAGAAGGATAAATCGCGGGCGCCCATCACTGCGAAGCTGATTGCCAATCTTTTG GAAACTGCGGGTTGTGATCATGTTATTACTATGGATCTCCATGCTTCACAAATTCAAGGG TTTTTTCATATCCCGGTTGATAATTTATACGGTGAACCAAGTGTGTTGAATTACATAAGG ACCAAAACAGATTTCAATAATGCGATACTGGTATCGCCTGATGCTGGTGGTGCGAAAAGG GTGGCTTCTTTAGCGGACAAGCTGGATATGAATTTTGCCTTGATTCATAAGGAGAGGCAA AAAGCTAATGAAGTTTCGCGAATGCTGCTTGTCGGTGATGTTGCTGGTAAGTCATGCTTG TTGATTGACGATATGGCTGACACGTGTGGTACGCTGGTGAAAGCCTGTGACACATTAATG GATCACGGTGCTAAGGAGGTTATCGCTATTGTCACACATGGTATATTTTCTGGCTCAGCT AGGGAGAAGTTAATAAATAGTAGGTTATCAAGAATTGTTTGCACCAACACGGTACCTGTT GATTTGGATTTGGACATTGTCGATCAGGTGGATATCAGCCCTACGATTGCAGAAGCTATC AGAAGATTGCATAATGGAGAATCAGTCTCATATTTATTTACACATGCGCCTGTTTAA
Protein Properties
Pfam Domain Function
Protein Residues318
Protein Molecular Weight34764.60156
Protein Theoretical pI6.43
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Ribose-phosphate pyrophosphokinase 2 MSTNSIKLLAGNSHPGLAELISQRLGVPLSKVGVYQYSNKETSVTIGESIRDEDVYIIQT GYGEHEINDFLMELLILIHACKTASVRRITAVIPNFPYARQDKKDKSRAPITAKLIANLL ETAGCDHVITMDLHASQIQGFFHIPVDNLYGEPSVLNYIRTKTDFNNAILVSPDAGGAKR VASLADKLDMNFALIHKERQKANEVSRMLLVGDVAGKSCLLIDDMADTCGTLVKACDTLM DHGAKEVIAIVTHGIFSGSAREKLINSRLSRIVCTNTVPVDLDLDIVDQVDISPTIAEAI RRLHNGESVSYLFTHAPV
References
External Links
ResourceLink
Saccharomyces Genome Database PRS2
Uniprot IDP38620
Uniprot NameKPR2_YEAST
GenBank Gene IDAY692977
Genebank Protein ID51013405
General Reference
  • Carter, A. T., Narbad, A., Pearson, B. M., Beck, K. F., Logghe, M., Contreras, R., Schweizer, M. (1994). "Phosphoribosylpyrophosphate synthetase (PRS): a new gene family in Saccharomyces cerevisiae." Yeast 10:1031-1044.7992503
  • Hove-Jensen, B. (2004). "Heterooligomeric phosphoribosyl diphosphate synthase of Saccharomyces cerevisiae: combinatorial expression of the five PRS genes in Escherichia coli." J Biol Chem 279:40345-40350.15280369
  • Dietrich, F. S., Mulligan, J., Hennessy, K., Yelton, M. A., Allen, E., Araujo, R., Aviles, E., Berno, A., Brennan, T., Carpenter, J., Chen, E., Cherry, J. M., Chung, E., Duncan, M., Guzman, E., Hartzell, G., Hunicke-Smith, S., Hyman, R. W., Kayser, A., Komp, C., Lashkari, D., Lew, H., Lin, D., Mosedale, D., Davis, R. W., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome V." Nature 387:78-81.9169868
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Hernando, Y., Carter, A. T., Parr, A., Hove-Jensen, B., Schweizer, M. (1999). "Genetic analysis and enzyme activity suggest the existence of more than one minimal functional unit capable of synthesizing phosphoribosyl pyrophosphate in Saccharomyces cerevisiae." J Biol Chem 274:12480-12487.10212224
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106