You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameLanosterol synthase
Synonyms
  • 2,3-epoxysqualene--lanosterol cyclase
  • Oxidosqualene--lanosterol cyclase
  • OSC
Gene NameERG7
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionCatalyzes the cyclization of (S)-2,3 oxidosqualene to lanosterol, a reaction that forms the sterol nucleus
Cellular LocationLipid droplet. Endoplasmic reticulum membrane; Peripheral membrane protein.
SMPDB Pathways
Cholesterol biosynthesis and metabolism CE(10:0)PW002545 ThumbThumb?image type=greyscaleThumb?image type=simple
Cholesterol biosynthesis and metabolism CE(12:0)PW002548 ThumbThumb?image type=greyscaleThumb?image type=simple
Cholesterol biosynthesis and metabolism CE(14:0)PW002544 ThumbThumb?image type=greyscaleThumb?image type=simple
Cholesterol biosynthesis and metabolism CE(16:0)PW002550 ThumbThumb?image type=greyscaleThumb?image type=simple
Cholesterol biosynthesis and metabolism CE(18:0)PW002551 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Steroid biosynthesisec00100 Map00100
SMPDB Reactions
(S)-2,3-epoxysqualeneLanosterin
KEGG Reactions
(S)-2,3-epoxysqualeneLanosterin
Metabolites
YMDB IDNameView
YMDB00262LanosterinShow
YMDB00547lanosterolShow
YMDB00727(S)-2,3-epoxysqualeneShow
GO Classification
Component
Not Available
Function
isomerase activity
intramolecular transferase activity
catalytic activity
Process
Not Available
Gene Properties
Chromosome Locationchromosome 8
LocusYHR072W
Gene Sequence>2196 bp ATGACAGAATTTTATTCTGACACAATCGGTCTACCAAAGACAGATCCACGTCTTTGGAGA CTGAGAACTGATGAGCTAGGCCGAGAAAGCTGGGAATATTTAACCCCTCAGCAAGCCGCA AACGACCCACCATCCACTTTCACGCAGTGGCTTCTTCAAGATCCCAAATTTCCTCAACCT CATCCAGAAAGAAATAAGCATTCACCAGATTTTTCAGCCTTCGATGCGTGTCATAATGGT GCATCTTTTTTCAAACTGCTTCAAGAGCCTGACTCAGGTATTTTTCCGTGTCAATATAAA GGACCCATGTTCATGACAATCGGTTACGTAGCCGTAAACTATATCGCCGGTATTGAAATT CCTGAGCATGAGAGAATAGAATTAATTAGATACATCGTCAATACAGCACATCCGGTTGAT GGTGGCTGGGGTCTACATTCTGTTGACAAATCCACCGTGTTTGGTACAGTATTGAACTAT GTAATCTTACGTTTATTGGGTCTACCCAAGGACCACCCGGTTTGCGCCAAGGCAAGAAGC ACATTGTTAAGGTTAGGCGGTGCTATTGGATCCCCTCACTGGGGAAAAATTTGGCTAAGT GCACTAAACTTGTATAAATGGGAAGGTGTGAACCCTGCCCCTCCTGAAACTTGGTTACTT CCATATTCACTGCCCATGCATCCGGGGAGATGGTGGGTTCATACTAGAGGTGTTTACATT CCGGTCAGTTACCTGTCATTGGTCAAATTTTCTTGCCCAATGACTCCTCTTCTTGAAGAA CTGAGGAATGAAATTTACACTAAACCGTTTGACAAGATTAACTTCTCCAAGAACAGGAAT ACCGTATGTGGAGTAGACCTATATTACCCCCATTCTACTACTTTGAATATTGCGAACAGC CTTGTAGTATTTTACGAAAAATACCTAAGAAACCGGTTCATTTACTCTCTATCCAAGAAG AAGGTTTATGATCTAATCAAAACGGAGTTACAGAATACTGATTCCTTGTGTATAGCACCT GTTAACCAGGCGTTTTGCGCACTTGTCACTCTTATTGAAGAAGGGGTAGACTCGGAAGCG TTCCAGCGTCTCCAATATAGGTTCAAGGATGCATTGTTCCATGGTCCACAGGGTATGACC ATTATGGGAACAAATGGTGTGCAAACCTGGGATTGTGCGTTTGCCATTCAATACTTTTTC GTCGCAGGCCTCGCAGAAAGACCTGAATTCTATAACACAATTGTCTCTGCCTATAAATTC TTGTGTCATGCTCAATTTGACACCGAGTGCGTTCCAGGTAGTTATAGGGATAAGAGAAAG GGGGCTTGGGGCTTCTCAACAAAAACACAGGGCTATACAGTGGCAGATTGCACTGCAGAA GCAATTAAAGCCATCATCATGGTGAAAAACTCTCCCGTCTTTAGTGAAGTACACCATATG ATTAGCAGTGAACGTTTATTTGAAGGCATTGATGTGTTATTGAACCTACAAAACATCGGA TCTTTTGAATATGGTTCCTTTGCAACCTATGAAAAAATCAAGGCCCCACTAGCAATGGAA ACCTTGAATCCTGCTGAAGTTTTTGGTAACATAATGGTAGAATACCCATACGTGGAATGT ACTGATTCATCCGTTCTGGGGTTGACATATTTTCACAAGTACTTCGACTATAGGAAAGAG GAAATACGTACACGCATCAGAATCGCCATCGAATTCATAAAAAAATCTCAATTACCAGAT GGAAGTTGGTATGGAAGCTGGGGTATTTGTTTTACATATGCCGGTATGTTTGCATTGGAG GCATTACACACCGTGGGGGAGACCTATGAGAATTCCTCAACGGTAAGAAAAGGTTGCGAC TTCTTGGTCAGTAAACAGATGAAGGATGGCGGTTGGGGGGAATCAATGAAGTCCAGTGAA TTACATAGTTATGTGGATAGTGAAAAATCGCTAGTCGTTCAAACCGCATGGGCGCTAATT GCACTTCTTTTCGCTGAATATCCTAATAAAGAAGTCATCGACCGCGGTATTGACCTTTTA AAAAATAGACAAGAAGAATCCGGGGAATGGAAATTTGAAAGTGTAGAAGGTGTTTTCAAC CACTCTTGTGCAATTGAATACCCAAGTTATCGATTCTTATTCCCTATTAAGGCATTAGGT ATGTACAGCAGGGCATATGAAACACATACGCTTTAA
Protein Properties
Pfam Domain Function
Protein Residues731
Protein Molecular Weight83460.70313
Protein Theoretical pI6.51
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Lanosterol synthase MTEFYSDTIGLPKTDPRLWRLRTDELGRESWEYLTPQQAANDPPSTFTQWLLQDPKFPQP HPERNKHSPDFSAFDACHNGASFFKLLQEPDSGIFPCQYKGPMFMTIGYVAVNYIAGIEI PEHERIELIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLPKDHPVCAKARS TLLRLGGAIGSPHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLPMHPGRWWVHTRGVYI PVSYLSLVKFSCPMTPLLEELRNEIYTKPFDKINFSKNRNTVCGVDLYYPHSTTLNIANS LVVFYEKYLRNRFIYSLSKKKVYDLIKTELQNTDSLCIAPVNQAFCALVTLIEEGVDSEA FQRLQYRFKDALFHGPQGMTIMGTNGVQTWDCAFAIQYFFVAGLAERPEFYNTIVSAYKF LCHAQFDTECVPGSYRDKRKGAWGFSTKTQGYTVADCTAEAIKAIIMVKNSPVFSEVHHM ISSERLFEGIDVLLNLQNIGSFEYGSFATYEKIKAPLAMETLNPAEVFGDIMVEYPYVEC TDSSVLGLTYFHKYFDYRKEEIRTRIRIAIEFIKKSQLPDGSWYGSWGICFTYAGMFALE ALHTVGETYENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDSEKSLVVQTAWALI ALLFAEYPNKEVIDRGIDLLKNRQEESGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALG MYSRAYETHTL
References
External Links
ResourceLink
Saccharomyces Genome Database ERG7
Uniprot IDP38604
Uniprot NameERG7_YEAST
GenBank Gene IDAY693043
Genebank Protein ID51013537
General Reference
  • Corey, E. J., Matsuda, S. P., Bartel, B. (1994). "Molecular cloning, characterization, and overexpression of ERG7, the Saccharomyces cerevisiae gene encoding lanosterol synthase." Proc Natl Acad Sci U S A 91:2211-2215.8134375
  • Shi, Z., Buntel, C. J., Griffin, J. H. (1994). "Isolation and characterization of the gene encoding 2,3-oxidosqualene-lanosterol cyclase from Saccharomyces cerevisiae." Proc Natl Acad Sci U S A 91:7370-7374.8041797
  • Johnston, M., Andrews, S., Brinkman, R., Cooper, J., Ding, H., Dover, J., Du, Z., Favello, A., Fulton, L., Gattung, S., et, a. l. .. (1994). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome VIII." Science 265:2077-2082.8091229
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Balliano, G., Viola, F., Ceruti, M., Cattel, L. (1992). "Characterization and partial purification of squalene-2,3-oxide cyclase from Saccharomyces cerevisiae." Arch Biochem Biophys 293:122-129.1731628
  • Milla, P., Athenstaedt, K., Viola, F., Oliaro-Bosso, S., Kohlwein, S. D., Daum, G., Balliano, G. (2002). "Yeast oxidosqualene cyclase (Erg7p) is a major component of lipid particles." J Biol Chem 277:2406-2412.11706015
  • Mo, C., Milla, P., Athenstaedt, K., Ott, R., Balliano, G., Daum, G., Bard, M. (2003). "In yeast sterol biosynthesis the 3-keto reductase protein (Erg27p) is required for oxidosqualene cyclase (Erg7p) activity." Biochim Biophys Acta 1633:68-74.12842197
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Oliaro-Bosso, S., Schulz-Gasch, T., Balliano, G., Viola, F. (2005). "Access of the substrate to the active site of yeast oxidosqualene cyclase: an inhibition and site-directed mutagenesis approach." Chembiochem 6:2221-2228.16235265